KEGG   Weissella koreensis: WKK_02165Help
Entry
WKK_02165         CDS       T01577                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
wko  Weissella koreensis
Pathway
Purine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:wko00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(438918..439487)
Genome map
AA seq 189 aa AA seqDB search
MTNEEAQKVLVITGNTGTGKTTVARYLAEKYHFPQVVTHTTRPPRAGEADGQDYYFETEA
SFPKNHYLEQVVYSNYHYGSSYEGLNRAWEKNSLITIVLDTAGALTYAQQLGSKVEVLYL
SVENAADLTQRLIDRGDQLERIQKRIQSAEFIRDLSVPDALKQYAHMIINNNWVKTQKEI
DRIIKNMLK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaagaagcgcaaaaagttttagtaattacgggaaatactgggacagggaaa
acgacggtagcacggtacttagcagaaaaatatcattttcctcaggtggtaacgcacact
acacgaccaccacgagcaggtgaagccgatggacaagattattattttgagacggaggct
agttttcctaaaaatcattatttagagcaggtagtctatagtaattatcattatggttct
tcatacgaaggcttgaatcgggcttgggagaaaaactcattaattacgattgttttagac
acagcgggagctttgacttatgcacaacaattgggatcaaaggttgaggtgctctatcta
tcagttgagaatgcggcggatttaacacaacgattgattgatcggggagaccagttagag
cggattcaaaagcggatacaaagtgctgaatttattcgagatttatcagtccctgatgca
ttaaaacaatatgcgcatatgattattaataataattgggtaaaaacgcaaaaagaaatc
gaccgaattattaaaaatatgctaaaataa

DBGET integrated database retrieval system