KEGG   Weissella koreensis: WKK_02300Help
Entry
WKK_02300         CDS       T01577                                 

Definition
beta-galactosidase small subunit
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
wko  Weissella koreensis
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:wko00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:wko00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(472002..472955)
Genome map
AA seq 317 aa AA seqDB search
MENTQNKLNLIFGDVGLGVHGPDHEYLFSYDKKGLESIRIAGREWLLEPVKPIFWRATTD
NDRGAGFPQKVASWLGADLFQTGSVKTIWVDQQILELPLPPVNNKYNGDESAQEVAILYE
YQLPVQPQTKVEILYQVNAIGQLKVKAHYFGQKGLPELPVFGVRFMIPTLTNRFIYTGLS
GETYPDRKQGGQFGTYHVQGIPVTPYLIPQDNGVHMETQTVTLERTSTKNNVEPVVHPFE
LTVRKTKQPFAFSCLPYTAAELENATHQEELPLPRKTVLSILGSVRGVGGIDSWGAEVLP
DYRISGEIDHEFEFMLE
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatacacagaataaactcaatttaatttttggggatgtgggtttgggcgtccat
ggtcctgatcatgagtatctttttagttatgataaaaaaggattggaatcgattcgaatt
gctggtcgagaatggctgttggaacccgttaagccgattttttggcgagctacgactgat
aatgatcgaggagcagggtttccgcaaaaagtagcttcttggttgggggccgatttattt
caaactggaagtgtcaaaactatctgggttgatcaacaaattcttgagttacccttacca
cctgttaataataaatataatggtgatgagagcgcgcaggaagttgcaattttatatgaa
tatcaattaccagttcaaccacaaacaaaggtagaaattttatatcaagtgaatgcaatc
ggtcagctaaaagttaaagcacattattttggacaaaaagggttacctgagttaccagtt
tttggagttcgattcatgattccgaccttaacgaatcgttttatttatactggactttca
ggggaaacttatcctgatcgaaaacagggcggtcaattcggaacctatcatgtccaagga
ataccggtaacaccgtatttgattcctcaagataatggagtacatatggagacccaaaca
gttacattagaacgaacgagtactaagaataatgtggagccggtagtacatccatttgag
ttaacagtcagaaaaactaaacagccatttgcctttagttgtttaccatatacagcagca
gaattagaaaatgcaacgcatcaagaagaattgcctttaccacgtaaaacggttttgagc
attttgggatctgtgcgcggagttgggggtattgatagctggggtgccgaagtattacct
gattatcgaatttcgggtgaaattgatcatgaatttgaatttatgttggaataa

DBGET integrated database retrieval system