KEGG   Weissella koreensis: WKK_02305Help
Entry
WKK_02305         CDS       T01577                                 

Definition
(GenBank) glycoside hydrolase family 2
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
wko  Weissella koreensis
Pathway
wko00052  Galactose metabolism
wko00511  Other glycan degradation
wko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    WKK_02305
  Lipid metabolism
   00600 Sphingolipid metabolism
    WKK_02305
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    WKK_02305
Enzymes [BR:wko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     WKK_02305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5
Motif
Other DBs
NCBI-ProteinID: AEJ23335
UniProt: F8HY49
Position
complement(472936..474828)
Genome map
AA seq 630 aa AA seqDB search
MLPQLAWLDDPKIFRVNQLPAHSDHQVYRNLIEAHQKQSSLEKSLNGTWDFYYTDQMETF
NSELEVPDFEKNTAVTTIEVPKHIELANFAPIQYVNTQYPWDARTYRRPPFTNQDEQIPG
VFSRADDNAVGTYRKIFKLDPDWQDQKVHINFAGVERAFYLWLNGQFVGYAEDSFSPSEF
DLTPYLKNNGENELIVQVFKHSTASFIEDQDFFRFFGIFRDVTLLLQPGVHVTDIALKPQ
VSADYQMGKLTGEFKLTGEFSQYELEIKIINPQGEIIFQGQPNLNHEIRLPEIKFYDMQL
WSHKNPQLYHIELIVKNQEHQLIEVATTTFGFRKIELDHQVLKLNGERLKILGVNRHEWN
PENGRVITRDDMLTDLKIFQEHHINAVRTSHYADQLSWYQLCDEHGIYMMAETNLESHGS
WQKMGQLEPSYNVPGSLPGWKDAVLDRAKTNYETFKNHPSVLFWSLGNESYAGTNLSEMQ
EYFHKVDSTRLVHYEGVVWDRQFEDQISDFESRMYASPAEVRKYLEQNPKKPFMLCEYMH
DMGNSLGGLAEYMQLFDDFDNYAGGFIWDYIDQALWVNDEISGQKVLRYGGDFDDRPSDY
GFSADGLLFANRLVKPAMQEVAYQYGKYTE
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgctaccacaattagcttggttagatgatccaaaaatttttagggtaaatcaacttcct
gcccatagtgatcatcaagtttatcgtaatttaattgaggcccatcaaaaacaaagttca
ctagaaaaaagtttgaatgggacttgggatttttattataccgatcaaatggaaactttc
aattcagaacttgaggtgcctgattttgaaaaaaatacagcagttacgaccattgaggtg
ccaaaacatattgaattagctaattttgccccaattcaatatgtaaacacccaatatcca
tgggatgcgcgaacctatcgtcgaccaccttttacgaatcaggatgaacaaattccaggg
gtttttagtcgtgctgatgataatgcggttggcacttatcgcaaaatttttaaattagat
cctgattggcaggatcaaaaggttcatattaattttgcgggagttgaacgggctttttat
ctttggttgaatggccaattcgtaggatatgccgaagatagtttttcgccatcggaattc
gatttaacgccatacttaaaaaataatggtgaaaatgagcttatcgttcaggtatttaag
catagtacagctagttttatagaagaccaagatttttttcgcttttttggaatctttcga
gatgtcacacttttactacaacctggggttcatgtaactgatattgctttaaagccacaa
gtcagtgccgattatcagatgggtaaattgacaggtgagtttaaattaacgggagaattt
agtcaatatgaattagaaatcaaaattattaatccgcaaggtgaaattatcttccaaggt
cagcctaatctaaatcacgaaattagattacctgaaattaaattttatgatatgcagtta
tggagtcataaaaatccacaactttaccatattgaactaatagttaaaaaccaagagcat
caattaattgaagttgctacaacgacttttggctttcgtaaaattgaacttgatcaccaa
gttttgaaattgaacggtgagcgtttaaaaatattgggagtaaacaggcatgaatggaat
cctgaaaatggacgggtcattacaagagatgatatgttgactgatttgaaaatttttcaa
gaacatcatatcaatgctgtacgaacctcacattacgcggaccagttgagttggtatcaa
ctttgtgatgagcatggaatctatatgatggctgaaactaatttggaatcacatggttca
tggcaaaaaatgggtcaacttgaaccttcatataatgtaccaggtagtctacctggttgg
aaagatgcagtattagaccgagccaagaccaattatgaaactttcaaaaatcatccttca
gttcttttttggtctttgggaaatgaatcatacgcaggaactaatctatctgagatgcag
gaatattttcataaggtcgattcaactcgtctagttcattatgaaggcgttgtatgggac
cgtcagttcgaagatcaaatttctgattttgaaagtcggatgtatgccagcccagctgag
gtgcgaaaatatttagaacaaaatccgaaaaagcccttcatgctttgtgaatacatgcat
gatatgggaaattcattgggcggattagccgaatatatgcaattatttgatgattttgat
aattatgcaggtggctttatttgggattacattgatcaagctctgtgggtcaatgatgaa
atatctggtcaaaaggtcttacgttatggtggtgattttgatgatcgtccatctgattat
gggtttagtgcagacggtctcttatttgcaaatcgcctagttaaaccagccatgcaggag
gtagcttatcaatatggaaaatacacagaataa

DBGET integrated database retrieval system