KEGG   Weissella koreensis: WKK_02310Help
Entry
WKK_02310         CDS       T01577                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
wko  Weissella koreensis
Pathway
wko00010  Glycolysis / Gluconeogenesis
wko00260  Glycine, serine and threonine metabolism
wko00680  Methane metabolism
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01200  Carbon metabolism
wko01230  Biosynthesis of amino acids
Module
wko_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_02310
  Energy metabolism
   00680 Methane metabolism
    WKK_02310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    WKK_02310
Enzymes [BR:wko01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     WKK_02310
Membrane trafficking [BR:wko04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    WKK_02310
Exosome [BR:wko04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   WKK_02310
  Exosomal proteins of melanoma cells
   WKK_02310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 TAF6_C
Motif
Other DBs
NCBI-ProteinID: AEJ23336
UniProt: F8HY50
Position
complement(475043..475762)
Genome map
AA seq 239 aa AA seqDB search
MAKLVLIRHGQSEWNALNLFNGWVDTKLSDKGIAQAKAAGEMLAKEGIEFDQAYTSVLTR
AITTLHYALEEAGQMFIPETKSWRLNERHYGALQGLNKADAAAKYGDEQVHQWRRSYDVL
PPLLTEQAKTVEVLGKTYPAFDRRYADVPEGQLPFGENLKVTLERVLPFWESNISKDLAA
GKNVVIAAHGNSLRALVKHIENISDDDILGVEIANGQPLVYDFDQDLKVLSKNVLTSEN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atggctaagttagttttgattcgtcatggtcaatcagagtggaatgcattgaatttgttc
aatggttgggttgataccaagttatcagataagggtattgcacaagctaaagcagctggt
gaaatgttggccaaagaaggcattgaatttgatcaagcatatacttcagttttgacacgt
gccatcactactttgcactatgcattggaagaagctggtcaaatgttcattcctgagact
aagtcttggcgtttgaatgaacgacactacggtgctcttcaaggtttgaacaaagctgat
gctgcagctaagtatggtgatgaacaagttcaccaatggcgtcgttcatacgatgtattg
ccaccacttttgactgaacaagctaagaccgttgaagttttgggaaagacttatcctgcc
tttgaccgtcgttacgctgatgttcctgaaggtcaattaccatttggtgaaaacttgaag
gtaactttggaacgcgttttgccattctgggaatcaaacatttcaaaggatttggctgca
ggtaagaacgttgtgattgctgcgcatggtaattcattacgtgccttggttaagcatatt
gaaaatatctcagatgatgatattttgggtgttgaaattgcaaatggacaaccattggtt
tacgattttgaccaagatttgaaggtcctttcaaagaacgttttgactagtgaaaactaa

DBGET integrated database retrieval system