KEGG   Weissella koreensis: WKK_03260Help
Entry
WKK_03260         CDS       T01577                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
wko  Weissella koreensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    WKK_03260
Enzymes [BR:wko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     WKK_03260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(662463..664916)
Genome map
AA seq 817 aa AA seqDB search
MAVDFDSQEYLAKVDAWWRATNYLSAGMIFLKSNPLFSVTDTPIVADDVKVKPIGHWGTI
SGQTFLYAHANRLINKYNLNMFYVGGPGHGGQVMVTNSYLDGTYTENYPEITQDIDGMAK
LFKKFSFPGGIGSHMTAQTPGSLHEGGELGYSLSHATGAILDNPDQIAFAVVGDGEAETG
PAMTAWHSIKFINPKNDGAVLPILDLNGFKISNPTLFSRMSDEEITKFFEGLGYSPRFIE
NDDIRDYAAYHKMAAKVLDQAIEDIQAIQKDARENGKYEDGTVAAWPVIIARLPKGWGGP
THNEAGEPIEGSFRAHQVPLNLSQKKMATLPQFEEWLNSYKPAELFNADGTLKDEVAAMA
PKGDKRMAANPITNGGRHRGEAAKNLELPDWKKFANDVNADNRGTELADGNRNMDMNVLS
GFFAEVAKMNPTSFRIFGPDETMSNRLWDMFKMTNRQWMEPINEPYDQHQAPEGRILDSQ
LSEHQAEGWLEAYTLTGRVGVFASYESFLRVVDSMITQHFKWLRHASEQSWRNDYPSLNL
ISTSTVFQQDHNGYTHQDPGMLTHLAEKKADFIRQYLPADGNSLLAVFDRAFTERHKVNH
VVASKQPRQQWFSVSEAETLANEGLMVVDWASTAPQGKADIVFASAGVEPTIETLAALHL
VNEAFPEVAMRYVNVVELMRLQNKNGAMNSERSLTDEEFTKFFGESGTPVVFGFHGYEDL
IQSFFYERGHLGLHVHGYREDGDITTTYDMRVYSELDRFHQAKDAVSALLENGVVASDKA
DVFFEKMDAILAKHFEVTRNEGRDIEEFTDWKWSPLV
NT seq 2454 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagattttgattcacaagaataccttgctaaagttgatgcttggtggcgcgct
accaactatctttcagccggtatgatctttttgaagagcaacccattgttctcagttact
gatacaccaatcgttgctgatgacgttaaggttaagcctatcggacactggggaactatc
tcaggtcaaactttcttgtatgcacatgcaaatcgtttgattaacaagtacaacttgaac
atgttctacgttggtggacctggtcacggtggacaagttatggttacgaactcatacttg
gatggaacttacactgaaaattatcctgagattactcaagatattgatggtatggcaaag
ttgttcaagaagttctcattccctggtggaattggatcacacatgaccgctcaaactcca
ggatctcttcacgaaggtggagaacttggatactcattgtcacacgcaactggtgcaatt
ttggacaatcctgaccaaatcgcatttgctgttgttggtgatggtgaagctgaaactggt
cctgcaatgactgcatggcactcaattaagtttatcaacccaaagaatgatggggctgtt
ttgcctatcttggatttgaacggattcaagatttcaaacccaactttgttctcacgtatg
tcagacgaagaaattactaagttctttgaaggtcttggatactcacctcgtttcattgaa
aatgatgatattcgtgactatgctgcatatcacaagatggctgctaaggttcttgaccaa
gctatcgaagatatccaagcaattcaaaaggatgcccgtgaaaacggaaagtatgaagat
ggaactgttgccgcatggccagtaatcatcgctcgcttgccaaagggttggggtggacct
acgcacaatgaagctggagaaccaatcgaaggttcattccgtgcgcaccaagttccattg
aacctttcacaaaagaagatggcaacattgccacaattcgaagaatggttgaattcatac
aagccagccgaattgttcaatgctgatggaactttgaaggatgaagtagctgcaatggca
cctaagggtgacaagcgtatggctgctaaccctatcactaacggtggacgtcaccgtggt
gaagctgcaaagaacttggaattgccagactggaagaagtttgctaacgatgttaatgcg
gacaaccgcggaactgaattagctgatggaaaccgtaatatggatatgaacgttttgtca
ggcttcttcgctgaagttgctaagatgaatcctacttcattccgtatcttcggacctgat
gagacgatgtcaaatcgtctatgggatatgttcaagatgacgaaccgtcaatggatggaa
ccaatcaacgaaccttatgaccaacatcaagctcctgaaggacgtattcttgattcacaa
ctttcagagcaccaagctgaaggttggcttgaagcttacacattgactggacgtgttgga
gtattcgcatcatacgaatcattcttgcgtgtcgtggactcaatgattactcaacacttc
aagtggttgcgtcatgcttcagaacaatcatggcgtaatgattacccatcattgaacttg
atttcaacttcaactgttttccaacaagaccacaacggttacacacaccaagatcctggt
atgttgactcacttggcagaaaagaaagcagactttatccgtcaatacttgccagctgat
ggtaactcattgttggccgtctttgaccgtgccttcactgaacgtcacaaggttaaccac
gtggttgcatcaaagcaacctcgtcaacaatggttctcagtttctgaagctgaaactctt
gctaacgaaggtttgatggttgttgactgggcttctactgctccacaaggtaaggctgac
atcgtcttcgcatctgctggtgttgaaccaacaatcgaaactttggctgctttgcacctt
gttaacgaagcattccctgaagttgcaatgcgttatgtcaacgttgttgaattaatgcgt
ttgcaaaacaagaatggtgccatgaactcagaacgttcattgactgatgaagaattcact
aagttcttcggtgagtcaggaacacctgttgtctttggattccacggttatgaagatttg
atccaatcattcttctacgagcgcggacatcttggacttcatgttcacggataccgtgaa
gatggtgacatcactactacttacgatatgcgtgtctactcagaattggatcgattccac
caagccaaggatgctgtttcagcattgcttgaaaatggagttgttgcatctgataaggct
gatgtcttcttcgagaagatggatgctattttggcaaagcacttcgaagttactcgtaac
gaaggtcgtgatatcgaagaattcactgactggaagtggtcaccattggtttaa

DBGET integrated database retrieval system