KEGG   Weissella koreensis: WKK_04310Help
Entry
WKK_04310         CDS       T01577                                 

Gene name
truA
Definition
tRNA pseudouridine synthase A
Orthology
K06173  
tRNA pseudouridine38-40 synthase [EC:5.4.99.12]
Organism
wko  Weissella koreensis
Brite
Enzymes [BR:wko01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.12  tRNA pseudouridine38-40 synthase
     WKK_04310 (truA)
Transfer RNA biogenesis [BR:wko03016]
 Eukaryotic Type
  tRNA modification factors
   Psudouridine synthases
    WKK_04310 (truA)
 Prokaryotic Type
    WKK_04310 (truA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
905741..906490
Genome map
AA seq 249 aa AA seqDB search
MPRYRAIVAYDGTDFSGWQVQPSKRTVQGELEKAVNRMAKNPEQPIRVQGSGRTDAGVHA
LGQVAHFDLPFDIPESGVRKGLATMLPFDIEIKKVEKVDADFHAQYSAHTKTYQYRLSNR
AFRDPFKRNYTGYWPRRIDPSKIEMAINDYLGEHDWQSFAASGFQAKTTIRTVTAVKFMN
DVEHEELIFEFTGTGFLYNQIRIMVGVLLEIGGGSRPVDDIPRLLAQKDRQQARLTAPAS
GLYLKSVDY
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgccaagatatcgtgctattgttgcctatgatggaaccgacttttctggttggcaagtt
caaccaagtaaacgaacggtgcaaggagaattagaaaaagctgtgaatagaatggctaaa
aatccggaacaaccaattcgagttcaggggtctggtcgaacggatgctggggtccacgct
ttaggtcaagtagcccattttgatttaccttttgatattcccgaaagtggggttcgtaaa
ggacttgcgacgatgctaccctttgatattgaaataaaaaaagtagagaaagttgatgcc
gactttcatgctcaatatagtgcacataccaaaacgtatcagtatcgtttatcaaatcgt
gcttttcgggacccatttaaacgcaattatactggatattggccgcgtcggattgatcct
agtaaaattgaaatggcgataaatgattatttaggtgaacacgattggcaaagttttgcg
gcttctggatttcaggctaaaaccacaatccggacggtcacggctgttaaattcatgaat
gatgttgagcatgaggaattgatttttgaatttacgggaaccggatttttgtataatcaa
attcgaattatggtcggcgttttattagaaattggtggtgggagtcgcccagttgatgat
atcccacgtctattagctcaaaaagatcgacaacaagcccgattaacagctccagctagt
ggtttgtatcttaaatcagttgattattaa

DBGET integrated database retrieval system