KEGG   Weissella koreensis: WKK_04415Help
Entry
WKK_04415         CDS       T01577                                 

Definition
alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
wko  Weissella koreensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    WKK_04415
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_04415
  Lipid metabolism
   00071 Fatty acid degradation
    WKK_04415
  Amino acid metabolism
   00350 Tyrosine metabolism
    WKK_04415
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WKK_04415
   00626 Naphthalene degradation
    WKK_04415
Enzymes [BR:wko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     WKK_04415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
925738..926784
Genome map
AA seq 348 aa AA seqDB search
MKAAIFEKAGLVTVQDIDKPTIQANDDVIIRVVRACVCGSDLWAYANGDNKQTHSVNDGH
EAIGIVEEVGSAITTVQPGDFVIAPFTHGCGECDACLAGFDGTCDRHQGATNWSNGFQSE
YIRFQYANWALIKIPGQPSDYSEGMIKSLTTLADVMPTGYHAARCADVQKGDKVVVIGDG
AVGQCAVIAAKMRGASQIVLMSRHEDRQKMALQSGATAVVAERGAEGIAKVREILGGGAD
AALECVGTEAAIDQALGVLHNGGRIGYVGVPHYNNHALGSTFAQNISVAGGSASVTTYDK
QLLLKAVLDGNINPGRVFTETYRLDDINQAYQDMQNRKTIKSMVFVAD
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcaatttttgaaaaggcggggttagttaccgttcaagatattgataagcca
actatccaagcaaatgatgatgtcatcattagagtcgtgcgtgcttgtgtttgtggatct
gatctatgggcttacgcaaatggcgacaataaacaaactcattctgttaatgatggtcat
gaggctattgggatcgttgaagaagttggttcagccatcacaacggtacaaccgggtgat
tttgtaattgcaccattcacacatggttgtggtgaatgtgatgcttgtcttgctggtttt
gatggaacttgtgatcgtcatcaaggtgcaacgaactggtctaatggtttccaatcagaa
tacattcgcttccaatatgccaattgggcattgattaagattcctggacaaccatcagat
tattctgaaggaatgatcaaatcactaactaccctagctgatgttatgccaactggatac
catgcagcgcgctgtgctgatgtccaaaaaggtgataaagtggtggtcatcggtgatggt
gcagttggtcaatgtgcagtgattgccgcgaaaatgcgaggggcttcacaaattgtactt
atgagtcgacatgaagaccgtcaaaagatggctttacaatcaggcgcaactgctgttgtt
gctgaacgtggagcagaaggaattgctaaagtacgtgagattcttgggggcggcgctgac
gctgcgcttgaatgtgtaggaactgaagctgccattgatcaagcacttggtgtacttcat
aatggtggccgaattggttatgttggtgttccacactacaataaccatgctttaggttca
acttttgctcagaatatttcagtggctggaggttctgcctctgtgacaacttatgataag
caattattgcttaaagctgttctggatggaaatattaatcctggtcgcgtctttactgaa
acataccgtttggatgatatcaatcaagcttaccaagacatgcaaaatcgtaaaacaatc
aaatcaatggtttttgtagctgattaa

DBGET integrated database retrieval system