KEGG   Weissella koreensis: WKK_04440Help
Entry
WKK_04440         CDS       T01577                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
wko  Weissella koreensis
Pathway
wko00010  Glycolysis / Gluconeogenesis
wko00071  Fatty acid degradation
wko00625  Chloroalkane and chloroalkene degradation
wko00626  Naphthalene degradation
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_04440
  Lipid metabolism
   00071 Fatty acid degradation
    WKK_04440
  Amino acid metabolism
   00350 Tyrosine metabolism
    WKK_04440
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    WKK_04440
   00626 Naphthalene degradation
    WKK_04440
Enzymes [BR:wko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     WKK_04440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C
Motif
Other DBs
NCBI-ProteinID: AEJ23760
UniProt: F8HYF8
Position
931183..932220
Genome map
AA seq 345 aa AA seqDB search
MKATVFIKPGKVEVQNLDKPVIEKETDAIIRVVRACVCGSDLWWYRGISEHESGSAVGHE
AIGVVETVGSAVDTIKPGDFVVVPFTHGCGHCAACLAGFDGDCLNRDSHSVGYQAEYLRY
DNANWGLVKIPGQPSDYSEEMLNSLLTLSDVMATGYHAAATAEVKPGDTVVVMGDGAVGL
CGVIAAKLRGATRIIAMSRHEDRQKLALEFGATDIVAERGDEAVAKVLELTDGGVDAVLE
CVGNEQSVETALQVGRPGAIVGRVGIPQKAEMNTNRLFRRNIGLRGGIAAVTTYDKATLL
DAVLNGEINPGKVFTQSFALDDIQAAYAAMDERKAIKSLVVVADK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcaactgtatttattaaacctggaaaagttgaagtacaaaacttagacaagccg
gttatagaaaaagaaactgatgcaattattcgtgtagttcgtgcgtgcgtgtgtggatct
gatttatggtggtatcgtgggatttcagaacacgaatcaggttcagcggttggtcatgaa
gcaattggagttgttgaaacagttgggtcagcagttgatacaattaagccaggggatttt
gttgtagttccgtttacacatggatgtgggcactgcgcagcttgtttggctggatttgat
ggtgattgtttgaatcgtgatagccactcagttggttatcaagctgaatatttacgttat
gataatgcaaattggggtctggttaagattccaggacaacctagtgactattctgaggaa
atgttaaattcattgctaactttatctgatgtgatggcaactggttatcatgcggcagca
acggctgaggttaagccaggtgataccgtagtagtcatgggtgatggtgcggttggtttg
tgtggagttatcgcggctaagttacgtggagcaacacgaattattgctatgagccggcat
gaagatcgtcaaaaattagctcttgaatttggagcgactgatatcgtagctgaacgtggt
gatgaagcagttgctaaggtgcttgaattaactgatggtggagttgatgcagtacttgaa
tgcgttggaaatgaacaatcagtggaaaccgccttacaagttggccgcccaggagctatt
gtcggtcgtgttggaattccacaaaaggctgaaatgaatacaaatcgattattcagacgt
aatattggcctccgtggtggaattgccgcagttacaacatatgataaagctactttgtta
gatgctgttttgaatggtgaaattaatccaggtaaggtatttacgcaaagctttgccttg
gatgatattcaagctgcctacgctgcaatggatgaacgaaaagctattaaatcattggtt
gtcgtggctgataagtaa

DBGET integrated database retrieval system