KEGG   Weissella koreensis: WKK_04685Help
Entry
WKK_04685         CDS       T01577                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
wko  Weissella koreensis
Pathway
wko00010  Glycolysis / Gluconeogenesis
wko00052  Galactose metabolism
wko00500  Starch and sucrose metabolism
wko00520  Amino sugar and nucleotide sugar metabolism
wko00521  Streptomycin biosynthesis
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01200  Carbon metabolism
Module
wko_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_04685
   00052 Galactose metabolism
    WKK_04685
   00500 Starch and sucrose metabolism
    WKK_04685
   00520 Amino sugar and nucleotide sugar metabolism
    WKK_04685
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    WKK_04685
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    WKK_04685
Enzymes [BR:wko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     WKK_04685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG FtsA
Motif
Other DBs
NCBI-ProteinID: AEJ23809
UniProt: F8HZA0
Position
986877..987842
Genome map
AA seq 321 aa AA seqDB search
MQKDKLIGVDLGGTTIKFAIMTADGEIQQKWSIRTNVLDDGEHIVPDIVESINHHLDLYE
LPKERIIGIGMGTPGTVDYQKGTVRSAYNLNWQETPVQVKAEIEQGTGLPLTIDNDANAA
ALGEQWRGAGENAQEVVFITLGTGVGGGIINDGHLMHGAYGTAGEVGHIVVKPDGYLCTC
GNHGCLEQYASATGVVHLAQDLAEAYAGKSELKAMIDDGAEVTSKIVFDLAKNDDYLANE
VVDQVAFYLGYASANLANTLNPSAIVIGGGVSAAGPFLLERVKTNFMKFAFQPVRENTDI
KLAVLGNDAGVYGAGLLSKQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagataaattaattggtgttgatttaggtggtacaacgatcaagtttgcgatt
atgactgcggatggtgaaattcagcaaaaatggtcgattcgtaccaacgttttagatgat
ggagaacatatcgtacctgatattgttgaatcaattaatcatcatcttgatctatatgaa
ttaccaaaagaacgtattattggaattggaatgggaactccaggtacggttgattatcaa
aagggaacagtccgatcagcttataatctaaattggcaagagacgccagttcaagttaaa
gctgaaattgaacaaggaactggcttacctttgacaattgataatgatgctaatgcagct
gctttgggagaacaatggcgtggtgccggtgaaaatgcacaagaagtggtcttcattaca
ttaggaactggtgttggcggtggaattatcaatgatggtcacttgatgcatggagcttat
ggaacagctggtgaagtaggtcatattgttgttaaacctgatggatacctatgtacatgt
ggaaaccatggttgtttggaacaatatgcttcagcaacgggggttgttcaccttgctcaa
gacttggcagaagcatatgctggaaaatcagaactaaaagcgatgattgatgatggagct
gaggtgacatctaaaattgtttttgatttagctaaaaatgatgattatttggcaaatgag
gtggttgatcaagttgcattctatcttggatatgcctcagctaatttggctaatacttta
aatccatcagctatcgttattggtggcggagtttcagcagctggacctttcttattagaa
cgggtgaaaactaactttatgaaatttgcattccaaccagtacgtgaaaatactgacatt
aaattggcagttttaggaaatgatgctggagtttatggagctggtttgttatctaaacaa
gcataa

DBGET integrated database retrieval system