KEGG   Weissella koreensis: WKK_04685Help
Entry
WKK_04685         CDS       T01577                                 

Definition
glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
wko  Weissella koreensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WKK_04685
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_04685
   00052 Galactose metabolism
    WKK_04685
   00500 Starch and sucrose metabolism
    WKK_04685
   00520 Amino sugar and nucleotide sugar metabolism
    WKK_04685
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    WKK_04685
   00524 Butirosin and neomycin biosynthesis
    WKK_04685
Enzymes [BR:wko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     WKK_04685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986877..987842
Genome map
AA seq 321 aa AA seqDB search
MQKDKLIGVDLGGTTIKFAIMTADGEIQQKWSIRTNVLDDGEHIVPDIVESINHHLDLYE
LPKERIIGIGMGTPGTVDYQKGTVRSAYNLNWQETPVQVKAEIEQGTGLPLTIDNDANAA
ALGEQWRGAGENAQEVVFITLGTGVGGGIINDGHLMHGAYGTAGEVGHIVVKPDGYLCTC
GNHGCLEQYASATGVVHLAQDLAEAYAGKSELKAMIDDGAEVTSKIVFDLAKNDDYLANE
VVDQVAFYLGYASANLANTLNPSAIVIGGGVSAAGPFLLERVKTNFMKFAFQPVRENTDI
KLAVLGNDAGVYGAGLLSKQA
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagataaattaattggtgttgatttaggtggtacaacgatcaagtttgcgatt
atgactgcggatggtgaaattcagcaaaaatggtcgattcgtaccaacgttttagatgat
ggagaacatatcgtacctgatattgttgaatcaattaatcatcatcttgatctatatgaa
ttaccaaaagaacgtattattggaattggaatgggaactccaggtacggttgattatcaa
aagggaacagtccgatcagcttataatctaaattggcaagagacgccagttcaagttaaa
gctgaaattgaacaaggaactggcttacctttgacaattgataatgatgctaatgcagct
gctttgggagaacaatggcgtggtgccggtgaaaatgcacaagaagtggtcttcattaca
ttaggaactggtgttggcggtggaattatcaatgatggtcacttgatgcatggagcttat
ggaacagctggtgaagtaggtcatattgttgttaaacctgatggatacctatgtacatgt
ggaaaccatggttgtttggaacaatatgcttcagcaacgggggttgttcaccttgctcaa
gacttggcagaagcatatgctggaaaatcagaactaaaagcgatgattgatgatggagct
gaggtgacatctaaaattgtttttgatttagctaaaaatgatgattatttggcaaatgag
gtggttgatcaagttgcattctatcttggatatgcctcagctaatttggctaatacttta
aatccatcagctatcgttattggtggcggagtttcagcagctggacctttcttattagaa
cgggtgaaaactaactttatgaaatttgcattccaaccagtacgtgaaaatactgacatt
aaattggcagttttaggaaatgatgctggagtttatggagctggtttgttatctaaacaa
gcataa

DBGET integrated database retrieval system