KEGG   Weissella koreensis: WKK_04765Help
Entry
WKK_04765         CDS       T01577                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
wko  Weissella koreensis
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WKK_04765 (ipk)
Enzymes [BR:wko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     WKK_04765 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1001691..1002548
Genome map
AA seq 285 aa AA seqDB search
MEVLERAYAKLNICLDTPFVHADGLQEWDMLMVSIDLADTVTIKTTDCHHDILVESTSGL
LPVNERNLAYQAAELMQSLANVDEGVEIHIQKRIPIAAGLGGGSSDAAAVMRALNRLWNL
NLSEAELAKLGLKIDADVPYCIYSRPSRVTGRGEIVEPLKKRMPPIYFVIAKPAVSVSTP
KLLRTVKYDKLEHGDMQELMNAVAQSSYPQLVKRMFNVLEPVSARQFPEIIRIREKMLQF
GADVAQMSGTGPTVFGMTQKASRAKHIYNGLKGFVGETYITGLAK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaagtcttagagcgtgcgtatgcaaaactaaatatttgtttggatacgccctttgta
catgctgatggcttgcaagagtgggacatgttaatggtttcaattgatttagccgatacg
gtaacaattaagacaactgattgtcatcatgatattttagttgagtcaacatcgggatta
ttaccagtaaatgagagaaatttagcataccaagcagctgagttaatgcagagcttggca
aatgttgatgaaggtgtggaaatccatattcagaagcggatcccaatcgcagcaggatta
ggcggcggttcttcagatgctgcagcagttatgcgggctttaaatcgtttgtggaattta
aatttatcggaagcggaattagctaagctgggcttaaaaattgacgctgatgtgccttat
tgtatttattcacggccttctcgagtgacgggacggggtgaaattgtggagccattgaaa
aaaagaatgccaccaatttattttgtgattgctaaaccagcagtgagtgtctcaacgcct
aaattattaaggactgtaaaatatgataaattagagcatggtgatatgcaggaattaatg
aatgcagtagctcaatcatcatacccacaattggtgaaacgaatgtttaatgttttagaa
ccggtctctgcacgacagtttccagaaattatccgaatccgggagaaaatgctccaattt
ggtgcagatgtggctcaaatgtctggaacgggaccaactgtttttggaatgactcaaaaa
gcaagtcgggcgaaacacatttataatgggctaaagggatttgtcggtgaaacgtatatt
accggtttagcaaaataa

DBGET integrated database retrieval system