KEGG   Weissella koreensis: WKK_05210Help
Entry
WKK_05210         CDS       T01577                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wko  Weissella koreensis
Pathway
wko00010  Glycolysis / Gluconeogenesis
wko00051  Fructose and mannose metabolism
wko00562  Inositol phosphate metabolism
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01200  Carbon metabolism
wko01230  Biosynthesis of amino acids
Module
wko_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_05210 (tpiA)
   00051 Fructose and mannose metabolism
    WKK_05210 (tpiA)
   00562 Inositol phosphate metabolism
    WKK_05210 (tpiA)
Enzymes [BR:wko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WKK_05210 (tpiA)
Exosome [BR:wko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WKK_05210 (tpiA)
  Exosomal proteins of bladder cancer cells
   WKK_05210 (tpiA)
  Exosomal proteins of melanoma cells
   WKK_05210 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA
Motif
Other DBs
NCBI-ProteinID: AEJ23913
UniProt: F8I081
Position
1102154..1102960
Genome map
AA seq 268 aa AA seqDB search
MEMMNRRPLVIANWKMNKLPSESSAYIQKIANPLRRYPDVIPVLAGQDVLLPAMVEAAKQ
TDISIGAENMYWQDRGAFTGETSPAALEDLGVTYVIIGHSERRNYFRETDEKVNLKAQAA
LQHNLIPIIAIDEAIKPKDDNDRSHWVVNEVIESLEGISAEVAKSVIIAYEPTASIGSGQ
AMTPALAQFSLRRIRLTLADMYDWDVANAVRIMYGGSVKPENAYELMIQDDIDGVLVGDS
ALDPDNFIELCQVANRALLTKIRRLDEF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatgaatcgacgcccactggttattgcgaattggaagatgaacaagttacca
agtgaatcgtcagcttatattcaaaaaattgcaaatccgctgagacgctatcctgatgtg
attcccgttttagcaggtcaggatgttttattgcctgcaatggttgaagcggccaaacag
acggatatctcaattggtgctgaaaatatgtattggcaagatcgtggtgcttttactggt
gaaacttcccctgcagctttagaagatttgggtgttacatatgtgattattggtcattct
gaacgacgaaattattttcgtgaaacagatgaaaaagttaatttaaaggcacaggctgct
ttacaacataatttaattcctattattgcaattgatgaagcaattaaacctaaagatgat
aatgatcgatctcactgggtggtaaatgaagttattgaatctttagaaggtatttctgcg
gaagtagccaaatccgttattatcgcctatgaaccgactgcatcaattgggagtggtcaa
gccatgaccccggcattagcacaatttagcttgcgacgaattcgtctaactttagctgat
atgtatgattgggatgttgcaaatgccgtgcgcattatgtatggtggttcagtgaaacca
gaaaatgcgtatgaattaatgattcaagatgatattgatggggtcttagttggtgattca
gcactagacccagacaattttattgaattatgccaagtagcaaatcgagcacttcttaca
aaaattagacgacttgatgagttttaa

DBGET integrated database retrieval system