KEGG   Weissella koreensis: WKK_05210Help
Entry
WKK_05210         CDS       T01577                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wko  Weissella koreensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WKK_05210 (tpiA)
   01230 Biosynthesis of amino acids
    WKK_05210 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_05210 (tpiA)
   00051 Fructose and mannose metabolism
    WKK_05210 (tpiA)
   00562 Inositol phosphate metabolism
    WKK_05210 (tpiA)
Enzymes [BR:wko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WKK_05210 (tpiA)
Exosome [BR:wko04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WKK_05210 (tpiA)
  Exosomal proteins of bladder cancer cells
   WKK_05210 (tpiA)
  Exosomal proteins of melanoma cells
   WKK_05210 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1102154..1102960
Genome map
AA seq 268 aa AA seqDB search
MEMMNRRPLVIANWKMNKLPSESSAYIQKIANPLRRYPDVIPVLAGQDVLLPAMVEAAKQ
TDISIGAENMYWQDRGAFTGETSPAALEDLGVTYVIIGHSERRNYFRETDEKVNLKAQAA
LQHNLIPIIAIDEAIKPKDDNDRSHWVVNEVIESLEGISAEVAKSVIIAYEPTASIGSGQ
AMTPALAQFSLRRIRLTLADMYDWDVANAVRIMYGGSVKPENAYELMIQDDIDGVLVGDS
ALDPDNFIELCQVANRALLTKIRRLDEF
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatgaatcgacgcccactggttattgcgaattggaagatgaacaagttacca
agtgaatcgtcagcttatattcaaaaaattgcaaatccgctgagacgctatcctgatgtg
attcccgttttagcaggtcaggatgttttattgcctgcaatggttgaagcggccaaacag
acggatatctcaattggtgctgaaaatatgtattggcaagatcgtggtgcttttactggt
gaaacttcccctgcagctttagaagatttgggtgttacatatgtgattattggtcattct
gaacgacgaaattattttcgtgaaacagatgaaaaagttaatttaaaggcacaggctgct
ttacaacataatttaattcctattattgcaattgatgaagcaattaaacctaaagatgat
aatgatcgatctcactgggtggtaaatgaagttattgaatctttagaaggtatttctgcg
gaagtagccaaatccgttattatcgcctatgaaccgactgcatcaattgggagtggtcaa
gccatgaccccggcattagcacaatttagcttgcgacgaattcgtctaactttagctgat
atgtatgattgggatgttgcaaatgccgtgcgcattatgtatggtggttcagtgaaacca
gaaaatgcgtatgaattaatgattcaagatgatattgatggggtcttagttggtgattca
gcactagacccagacaattttattgaattatgccaagtagcaaatcgagcacttcttaca
aaaattagacgacttgatgagttttaa

DBGET integrated database retrieval system