KEGG   Weissella koreensis: WKK_05995Help
Entry
WKK_05995         CDS       T01577                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
wko  Weissella koreensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wko00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WKK_05995
Enzymes [BR:wko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     WKK_05995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1258804..1261341
Genome map
AA seq 845 aa AA seqDB search
MNDIRDLMVDDAPAMIAQVQGIIFSATDSFYKVIAVKIDEKNFEYDVDEITVTGSFGDLQ
IGSNYQFTGQLKNHARFGQQFASEHYQRLDTSSAAGLVQYLSGADFTGIGAKTAEKIVDS
LGTDAIDQILDNPAVLNNIGLSEKQSSTLVEQLKQSDGMERSIIALNQFGFGSALATTIY
EHYENETLEILKNDPYRMVWEIDGVSFNRIDQIVLQEGLDPLDPRRIQAGVVAAMNKATF
EQGDTYVELSVLSYAAKRSLERNDHTQIEPEVIQNALLDLVEQEIVVADDDRLFMTNLYY
AEVGIAQRIVELNSQKGIFPRRDVEKVLKQVEKQHQLQYTDEQHEAMLAALTSKLFILTG
GPGTGKTTIINGVVDAFGRLLQQDGLDEDKIESAIKLAAPTGRAAKRLSEATGKPAATIH
RLLGVSGRESLADLDLDPLEGQLLIIDEMSMVDTELFSFLLENTPNSMQIILVGDKDQLP
SVGPGRVFYDLLSSGKLNYRELATIHRQDADSTIIELANEVKRGQLPSDLMQRQPDRSFF
PAHVQQIPDAMEKIIMSWIERGNSVRDMQILAPMYKTDAGVNRLNLLAQDLFNPKTKQKR
EIMWREGDFEFGFRIGDKVMQKANDPEHDVFNGDIGYIKTIMFAKDPENEMKVDYIEVDF
DNNYVLYQRTDFMNLTLAYATTIHKAQGGEYSLVIMPLVQAFNRMLQRNLLYTGLTRAKD
SLVLLGEPGAYQQAAQTEGAKRKTMLPTRLEKALVGILPKGPTQKVEVSDQDVAVDWDNK
VISEKGSKTESIDDVTEPGLNHEQQSIAIKEEVPVNKNQLKLAMIQAQTIDPNVGMMGVS
PYDFM
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatattcgcgatttaatggtggatgatgcaccagcgatgattgctcaggttcaa
ggaattattttttcagcaacagatagcttttataaagtgattgcagttaagattgatgaa
aagaactttgaatatgatgtggatgaaattacagtcactggttcttttggagatcttcaa
attggatcaaattatcaattcactggtcaacttaaaaatcatgctcgttttggacaacag
tttgcgagtgaacattatcaacggttagataccagttcagcagcaggattagtgcaatac
ctttctggagctgattttacgggaattggtgctaaaacagctgaaaaaattgtcgatagt
ttaggtacagatgcaattgaccaaattttagataatccggctgtgttaaataatattggg
ttgagtgaaaagcaaagttccacgcttgtagaacagttaaaacaatccgatgggatggaa
cgttcaattattgctttgaaccaatttggctttggatcggctttagcaactactatttat
gagcactatgaaaatgaaaccttagaaatccttaaaaatgatccatatcgaatggtgtgg
gaaattgacggagtttcatttaatcgaattgatcaaattgttttacaagaaggtttggat
ccccttgatcccagacgcattcaagcaggggttgtcgcagctatgaataaagcgactttt
gaacaaggggacacatatgttgaattaagtgttctaagttatgctgctaaacggtcgtta
gaacgaaatgaccatacacaaattgaaccggaagtaatacaaaatgctttgctggattta
gtagagcaagaaattgttgttgcagatgatgatcggttatttatgaccaacttatactat
gcagaagttggaattgctcaacgaattgtggaactaaattcgcaaaaaggtatctttcca
agacgtgacgttgaaaaagtccttaagcaggtagaaaagcaacatcaactgcaatatact
gatgagcagcatgaagcaatgctagccgctttaacaagtaaattgtttattttaacggga
ggacctgggaccggtaaaactaccattattaatggggttgtcgatgcctttggccgtttg
ttacaacaagatggtttagatgaagataaaattgagtcagcaattaagttagcagcacct
accggacgagcagctaagcgtttatccgaagcgactgggaaaccagcggcgacaattcac
cgtttgctaggtgtttcaggacgtgaaagtttagccgatttagatttagatccattagaa
gggcaacttttaataattgatgagatgtcaatggtagatactgaactatttagcttcttg
ttagaaaacacccctaattcaatgcaaattattttagtaggagataaagatcaactgcca
tcagtaggtccgggtcgagttttctatgatttgctaagtagtggaaagttaaattatcgc
gaattggcaacaattcatcgacaagacgcagattctacgattattgaattagctaatgaa
gttaaacgtgggcaactacctagtgatttaatgcagcgtcagcccgatcgttcatttttc
cccgcacacgttcaacaaattccggatgcgatggaaaaaatcattatgagttggattgaa
cgaggcaattcagttcgcgatatgcaaattttagcgccgatgtataaaactgatgcagga
gtaaaccggttaaatctattagcgcaagatctttttaatcctaagacaaaacagaagcgt
gagataatgtggcgtgaaggcgattttgaatttggctttagaattggcgataaagtcatg
caaaaagccaatgatccagaacacgatgtttttaatggtgatattggttatatcaaaacg
attatgtttgcgaaagatcctgaaaatgaaatgaaagttgattacattgaagttgatttt
gacaataattatgttttgtatcaaagaactgattttatgaatcttactttagcttatgca
accacaattcataaagctcaaggcggtgaatattcattagttattatgccgttagtacag
gcttttaaccgaatgctacaacgcaatttgctttacactggccttacacgagcgaaggat
tcgttggttctattgggcgaaccaggggcatatcaacaggctgctcaaactgagggagct
aaacggaaaacgatgctacctacgcgtttggaaaaagctttagtgggaattttacctaaa
ggcccaacacaaaaggtggaagtttccgatcaagatgtagcagtagattgggataataaa
gttatatcagaaaagggttctaaaactgaatcgatcgatgacgtaactgagcctggttta
aaccatgagcaacaatctatagcgattaaagaggaagtaccagttaataaaaatcagctt
aaactcgccatgattcaagcacaaacgatagaccccaatgtggggatgatgggggtgtca
ccttatgactttatgtaa

DBGET integrated database retrieval system