KEGG   Weissella koreensis: WKK_06170Help
Entry
WKK_06170         CDS       T01577                                 

Definition
carbamoylphosphate synthase small subunit
Orthology
K01956  
carbamoyl-phosphate synthase small subunit [EC:6.3.5.5]
Organism
wko  Weissella koreensis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    WKK_06170
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WKK_06170
Enzymes [BR:wko01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     WKK_06170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1299401..1300486
Genome map
AA seq 361 aa AA seqDB search
MTQRYLILQDQTVFKGEAFGSPATTFGEIVFNTAMSGYQEIITNPIYHNQIVMFTTPTIG
ATGINHRADEAIVPTIKGVVAREISDVSTNRLQQMSLDSFLRRHNIPGISQIDTRALARH
LRKTGTQKASIVDVPDDHAFDQLRAMVLPTNQVAQASTPKPYANPGRGADVVILDFGLKN
GILRSLRDYDANITVLPYDATLEQIVNLDPDGIVLSSGPGNPLKLNESILKLIRMVQTEM
PLLGIGLGHELFALANGAELEPLTFEHHGMNHPIREQITGEIIFANQGSGYAVNRESLKE
TELMVTHLDLMDKSILGIRHRDYPAFSVQFFPDGAPGPYEATDIFAEFMEMVTARKGGNL
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcgatatttaatactacaagaccaaacggtgttcaaaggggaagcttttgga
tcacccgcaacaacttttggtgaaattgtctttaatacagccatgtcggggtatcaagag
attattaccaatccaatttatcataatcaaattgtaatgtttacaacaccaactattgga
gctacagggattaatcatcgagcagatgaggcaatcgttcctacaattaaaggagtcgtt
gctcgtgaaatttcagacgtttcaaccaatcgtctgcaacaaatgagtttagactctttt
ttgaggcgtcacaatatacctggaatttcacagattgatacacgggctttagctcgacat
ttgagaaaaacgggaacacaaaaagctagtattgttgatgttccagacgaccacgctttt
gatcaattaagagcaatggttttgccaacaaatcaagtggcacaggcttcaacacctaaa
ccttatgcaaatcctggtcgaggtgctgatgtagtcatattagattttggtttgaagaat
ggaattttacgtagtttaagagattatgatgctaatatcacggttttaccatacgacgcg
acattagaacaaattgttaatttggatccagatgggattgttttatcatcaggacctggg
aatcctttgaagctaaatgagtcgattttaaaattgattcgaatggttcaaacggaaatg
cccttgctaggaattggactaggtcatgaattatttgcccttgcaaatggtgctgaatta
gaaccattgacttttgaacatcatggaatgaatcatccaattcgagagcaaattacaggt
gagatcatctttgcaaatcaagggagtggttatgctgtcaatcgagaatctttgaaagaa
acggaattaatggtcactcacttggatttgatggacaaatcaattttagggataaggcat
cgagactatccagcatttagtgttcagtttttcccagacggtgcacctggaccgtatgaa
gcaactgatatttttgcagaatttatggaaatggtgacagctcggaaaggggggaactta
cgatga

DBGET integrated database retrieval system