KEGG   Weissella koreensis: WKK_06345Help
Entry
WKK_06345         CDS       T01577                                 

Definition
(GenBank) pyruvate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
wko  Weissella koreensis
Pathway
wko00010  Glycolysis / Gluconeogenesis
wko00020  Citrate cycle (TCA cycle)
wko00620  Pyruvate metabolism
wko01100  Metabolic pathways
wko01110  Biosynthesis of secondary metabolites
wko01120  Microbial metabolism in diverse environments
wko01130  Biosynthesis of antibiotics
wko01200  Carbon metabolism
Module
wko_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WKK_06345
   00020 Citrate cycle (TCA cycle)
    WKK_06345
   00620 Pyruvate metabolism
    WKK_06345
Enzymes [BR:wko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     WKK_06345
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H
Motif
Other DBs
NCBI-ProteinID: AEJ24139
UniProt: F8HZD2
Position
1340939..1342255
Genome map
AA seq 438 aa AA seqDB search
MTEIFKMPDIGEGMAEGDITNWLVEVGDQVAVDDSVAEVQNDKLMQEILSPYAGKVTKLF
VDPNTTVSVGDPLIEFDGDGTGGSSDVKPKQEQVSKQDEATTVNVTEATPTSNQVEVKSP
VMASNGQILAMPSVRHYAAEHQIDLNQVLATGRHGHITLQDVQNFSGSTVSQNQTSSTET
KNVPISNPIAEVEAKPTPIVHAPETKEGRQPMTGVRKAIAKAMAHQNETIPTVTNFDSVE
VSKLVQHRKAFKDQMKEQGIHLTYLAYAVKAMAAVGKKFPELNSSLDMNTKEIVYHNTVN
MGIAVNAPAGLYVPVIAHAESKSIQAIAQEISELAEAVRNNSIKPAQMQGGTMTISNLGS
ARGTWFTPIINGQEVMILGLGSILKEPIVDAEGELSIGQNMKLSLSYDHRLIDGMLAQNA
MNYLKQLLSDPAFMLMEV
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatttttaaaatgcccgatattggtgaaggaatggctgaaggtgatattacc
aattggcttgttgaagtgggtgatcaggtcgcagttgatgattcagtggccgaagtccaa
aatgataagttaatgcaagaaatattatcaccatatgcagggaaggtgacaaaactattt
gttgatcccaatactacggtttccgttggagatccattgattgaatttgatggggacgga
acaggtggaagttcagatgtaaaaccaaaacaagaacaagtgtcaaaacaagatgaggct
acgacagttaatgtcacagaagctacgccaacttcaaatcaagtggaagttaaaagtccg
gttatggcatcaaatggtcaaattttagcaatgccatctgttcgtcattatgcagcagaa
catcaaatagacttgaaccaagtgttagcaacaggacgacatgggcatattactttgcag
gatgttcagaatttttctggatcaactgtatctcaaaatcaaacatcgtcaacagaaact
aaaaatgttccaatatcaaatcctatagctgaagtggaagctaaaccaactccgattgtt
catgcacctgaaacaaaagaaggacgtcagccaatgactggtgttcgtaaggcaattgct
aaggctatggcacaccagaatgaaacaatcccgactgttactaacttcgatagtgttgaa
gtttctaagttggtccagcatcgaaaagctttcaaagatcagatgaaggaacagggaata
cacctaacttatttagcttatgccgttaaagcaatggctgctgtagggaaaaaattccct
gaattaaattcttcattagatatgaatactaaggaaattgtatatcataacactgttaat
atgggaattgctgttaatgcgcccgctggattatatgtaccagtaattgcccatgctgaa
agtaaatcaattcaagcaatcgcacaagaaattagtgaattagcagaagcagttcgtaat
aattcgattaagcctgcacaaatgcaaggtggtacaatgactatttcaaatctgggttct
gctcgcggaacttggtttacaccaatcattaatggacaagaagttatgattcttggctta
ggttcaattttgaaggagccaattgttgacgcagaaggtgaactaagtattggacaaaat
atgaagctttccttaagttatgatcatcggttgattgacggtatgttagcacaaaatgcc
atgaattatttaaagcaattgttatctgatccagcatttatgttaatggaggtgtag

DBGET integrated database retrieval system