KEGG   Weissella koreensis: WKK_06520Help
Entry
WKK_06520         CDS       T01577                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
wko  Weissella koreensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:wko00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    WKK_06520
   00630 Glyoxylate and dicarboxylate metabolism
    WKK_06520
   00640 Propanoate metabolism
    WKK_06520
   00650 Butanoate metabolism
    WKK_06520
  Lipid metabolism
   00071 Fatty acid degradation
    WKK_06520
   00072 Synthesis and degradation of ketone bodies
    WKK_06520
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    WKK_06520
   00310 Lysine degradation
    WKK_06520
   00380 Tryptophan metabolism
    WKK_06520
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    WKK_06520
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    WKK_06520
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WKK_06520
Enzymes [BR:wko01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     WKK_06520
Exosome [BR:wko04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   WKK_06520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1375690..1376874
Genome map
AA seq 394 aa AA seqDB search
MERVYIIGAKRTPIGKFGGTLSSLTASDLGSFVIKGALDQSGLEADQVSQVLMGNVVQAG
QGQNPARQAALKAGLPIQVPSITINDVCGSGLSSINMGAALIQAHQADIVVAGGMESMSK
APYIVDQARFGARLGDGRMIDALLSDALTDAQGGYHMGITAENVAKKYDISREEMDEFSY
QSHQRAVSAQDKHRFDDEIVSLPMIDRKGNSYVVDQDEAPRRDTSLEKLAKLKPVYQEDG
AVTAGNASGLNDGAAAVVLISESKMHELGIEPLAQWQASALVGLEPELMGIGSYYAVEKL
FKDHPDFKQSEVDYFELNEAFAAPSLVVGDQLLGLDPAIVNPNGGAIALGHPVGASGSRI
LVTLIYELIHDDKKTGVAALCVGGGMGVSALITR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggagcgagtttatattattggggcaaaacgaaccccaattggtaagtttggaggcaca
ttgtcttccttaacggcctcggatttaggctcatttgtaattaaaggagctttagatcaa
tcaggtttagaggctgatcaagttagtcaagtcttgatggggaatgtagtccaagcgggt
caaggtcaaaatccggctcgtcaagctgctttaaaggccggacttccgatccaagtacca
tcaataacgattaatgatgtgtgtggatcaggactatccagcatcaatatgggcgcagct
ttaattcaagcacaccaagcagatatcgttgttgctggggggatggaaagtatgtctaaa
gccccttatattgtcgatcaagcccgttttggagcccgtttgggtgatggtaggatgatt
gatgccttattgtcggatgctttgactgacgctcaaggtggttatcatatgggaattact
gcggaaaacgttgctaaaaaatatgatatttcacgagaagagatggatgaatttagttat
caaagtcatcaaagagcagtgagtgcacaagataaacaccgctttgatgatgaaattgta
tcgttaccaatgattgatcgtaaaggtaattcttatgttgtcgatcaagatgaggcaccg
cgacgggatacatcattagaaaaattggccaaattgaagccagtttatcaagaagatggt
gcagttacggcggggaatgcttcaggcttaaatgatggtgcagctgcagtcgtattaatc
agtgaaagcaagatgcacgaattaggaatagaaccattagcacagtggcaagcgtctgca
ttagtagggctagagcctgaactaatgggaattggctcatactatgctgttgaaaagctt
tttaaagatcatcctgattttaaacaatctgaagttgattattttgaattaaatgaagct
tttgcggcaccatcattggtagttggtgatcaattattaggattagatccagcgattgtg
aaccctaatggtggtgcgattgcgttaggacatcctgttggtgcatccggaagtcgaatt
ttagttactttaatttatgaacttatccatgatgataagaaaactggagttgcggcactc
tgtgtaggtggtggaatgggtgtttcagcgttaattacacgataa

DBGET integrated database retrieval system