KEGG   Wolbachia wMel (Drosophila melanogaster): WD0091Help
Entry
WD0091            CDS       T00160                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WD0091 (tpiA)
   01230 Biosynthesis of amino acids
    WD0091 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WD0091 (tpiA)
   00051 Fructose and mannose metabolism
    WD0091 (tpiA)
   00562 Inositol phosphate metabolism
    WD0091 (tpiA)
Enzymes [BR:wol01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WD0091 (tpiA)
Exosome [BR:wol04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WD0091 (tpiA)
  Exosomal proteins of bladder cancer cells
   WD0091 (tpiA)
  Exosomal proteins of melanoma cells
   WD0091 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
83976..84704
Genome map
AA seq 242 aa AA seqDB search
MSFLIVANWKMNGMRSSFVDFIGKLNNKSNEITSKLVICPPFTSFPSSIELNNNIDIGAQ
NCHHKKFGSYTGEISAEMLKELGCTYVMLGHSERANEKDSEIKLKSEIAIESGLHPIICV
GENSEDYKNEKTKEVIEYQCKNRLPTHGEYTVAYEPIWAIGTGHVPNNDAIAKVIEVIKL
CTSKKHIIYGGSVSSENIENLLSISNLSGVLIGSASLDFDHFYKIIQQVEKKFSLINSKI
SN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttttaatagtagcaaattggaaaatgaatggaatgcgttcttcatttgttgac
tttataggcaaacttaacaacaagagcaacgaaattacctctaagctagtgatttgccct
ccttttacgtcatttccaagcagtatagagttgaacaataatattgatataggagcacag
aattgccatcataaaaagttcggttcttacacaggtgaaattagtgcagaaatgttaaaa
gaactagggtgtacttacgtaatgcttgggcattctgaaagggctaatgaaaaagatagt
gaaataaaacttaagtcggaaatagcaatagaatcaggcttacacccaattatctgtgtg
ggtgaaaattcagaagattataagaatgaaaaaacaaaagaagtaatagaatatcaatgc
aaaaaccgtttgccaacacacggtgaatataccgtagcatatgagccaatatgggcaata
ggcacaggtcatgtgccaaataatgatgcaattgctaaggtgatagaggtaataaaattg
tgtactagtaaaaaacacattatatatggtggttcagtcagttcagaaaatatagaaaat
ttgctcagtatctcaaatttatcaggagttttaattggcagtgcaagcttagatttcgat
cacttttataaaattatacaacaagttgaaaaaaagttttctcttatcaattctaaaatc
agcaactaa

DBGET integrated database retrieval system