KEGG   Wolbachia wMel: WD0091Help
Entry
WD0091            CDS       T00160                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wol  Wolbachia wMel
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:wol01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:wol01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:wol00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:wol00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:wol00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
83976..84704
Genome map
AA seq 242 aa AA seqDB search
MSFLIVANWKMNGMRSSFVDFIGKLNNKSNEITSKLVICPPFTSFPSSIELNNNIDIGAQ
NCHHKKFGSYTGEISAEMLKELGCTYVMLGHSERANEKDSEIKLKSEIAIESGLHPIICV
GENSEDYKNEKTKEVIEYQCKNRLPTHGEYTVAYEPIWAIGTGHVPNNDAIAKVIEVIKL
CTSKKHIIYGGSVSSENIENLLSISNLSGVLIGSASLDFDHFYKIIQQVEKKFSLINSKI
SN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttttaatagtagcaaattggaaaatgaatggaatgcgttcttcatttgttgac
tttataggcaaacttaacaacaagagcaacgaaattacctctaagctagtgatttgccct
ccttttacgtcatttccaagcagtatagagttgaacaataatattgatataggagcacag
aattgccatcataaaaagttcggttcttacacaggtgaaattagtgcagaaatgttaaaa
gaactagggtgtacttacgtaatgcttgggcattctgaaagggctaatgaaaaagatagt
gaaataaaacttaagtcggaaatagcaatagaatcaggcttacacccaattatctgtgtg
ggtgaaaattcagaagattataagaatgaaaaaacaaaagaagtaatagaatatcaatgc
aaaaaccgtttgccaacacacggtgaatataccgtagcatatgagccaatatgggcaata
ggcacaggtcatgtgccaaataatgatgcaattgctaaggtgatagaggtaataaaattg
tgtactagtaaaaaacacattatatatggtggttcagtcagttcagaaaatatagaaaat
ttgctcagtatctcaaatttatcaggagttttaattggcagtgcaagcttagatttcgat
cacttttataaaattatacaacaagttgaaaaaaagttttctcttatcaattctaaaatc
agcaactaa

DBGET integrated database retrieval system