KEGG   Wolbachia wMel (Drosophila melanogaster): WD0478Help
Entry
WD0478            CDS       T00160                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    WD0478
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WD0478
Enzymes [BR:wol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     WD0478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(460347..461741)
Genome map
AA seq 464 aa AA seqDB search
MTKESLVKTDIVKVEDKKAVRSFFKILGGVADAVRSWIGNISPDLSNSRDIDSLVLKMNE
CLNPKGGEVSARKNAVSLGNLYLSLSEKGKIKFLQTLAEKFNPNKAEIDEKIREYKKNQD
PELNYKFEQDLIKILESPRSKILKQFISLPEGLKFIVDMRSDVLKLKNQYRSLNPLESEL
KNILYTWVDVDLLDLRQIIWDSPASLLEKLIKYEAVHKISSWDDLKNRLGLCFAFFHYKI
PNEPLIFVEVALVDKIADSIQHLLDESVPSNDPSNASTAIFYSISNTQAGLSGISLGNFL
IKRVVEKLSQEFKSIKTYATLSPIPGFTKWLKNNLNQDVTLLGKLNIKQSSAEILESAEQ
LKINVECINETKQCMLKLCAYYLLKVNNSNGNAYDPVAHFHLSNGASIKQLNWMADTSEK
GISQSAGMMVNYLYELPKIDNNHENYMVNKVISCSKKVSSMLKE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaatcattggtaaaaactgatatagtgaaagttgaagacaaaaaggcggta
agaagcttttttaaaatactaggtggagtggcagatgctgtaagatcgtggattggtaac
atcagtcctgatttaagcaacagtcgcgatatcgatagtttagtcttgaagatgaacgag
tgcttaaatccaaagggaggggaggtttcagcacgtaaaaacgctgtatctcttggtaac
ttgtacttaagcttatcagagaaaggtaaaataaaatttctacaaaccctggcagaaaaa
tttaatccgaataaagcggaaatagatgagaaaattagagagtataagaaaaaccaagat
cccgagttaaactataaatttgaacaggatttaataaaaattcttgaatcaccgcgttct
aaaatattgaagcaatttatttctttaccagaaggccttaagtttattgttgatatgcgt
tctgacgtgcttaagctaaagaaccaatatagaagcttgaatccactagaaagcgaatta
aaaaatatactctatacttgggttgatgttgatctacttgatcttcgtcaaatcatctgg
gattcacctgcatcattgctagaaaaacttataaaatatgaagctgtgcataaaatttcc
tcttgggatgacttaaaaaacaggctgggtctctgttttgctttttttcattacaagata
ccaaacgaacctctaatttttgtagaggttgcattggtggataagattgcagatagtatt
caacaccttttagatgagtcagtaccttcaaatgatccgagtaatgcaagcactgctata
ttctattcaatatcaaacactcaagcagggttatctggaatcagccttggtaattttttg
atcaaaagggttgtagaaaagctatcacaggagtttaaaagtataaaaacatatgcaact
ctttctccaatacctggctttacgaaatggctaaaaaacaatctaaaccaagatgtcact
ttattgggcaaactaaatataaaacaatctagtgcagaaattttagaaagtgcagagcaa
ttaaaaattaacgttgaatgtataaatgaaactaaacaatgcatgcttaaactatgtgca
tattatttactaaaagtgaataatagtaatgggaatgcttatgatccggtggcgcatttt
catttaagcaatggtgcatcgataaaacaattaaactggatggcggatacttctgaaaaa
ggtattagtcagtcggctggaatgatggtaaattatctgtatgagttgcctaaaatagat
aataatcatgaaaactatatggttaataaagtgatttcctgctcgaaaaaagtgtcgtct
atgttgaaggagtaa

DBGET integrated database retrieval system