KEGG   Wolbachia wMel: WD0544Help
Entry
WD0544            CDS       T00160                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase E2 (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wol  Wolbachia wMel
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:wol01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:wol00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:wol00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
528616..529788
Genome map
AA seq 390 aa AA seqDB search
MSKIIEIRAPKTLGGESVTEGIVKIKKGIGEAVKVDDLIFEIETDKTALELTAEASGQIT
EFLIKEDDVISPDQLLAKLSMGEVKEEARKEDKSESAAKKDAPSARKIMEENAISAESVK
GTGMGGRITKADVIGHMNKAEQPAIKQYELPKSVVNGEQREERVKMSKIRQVIAARLKAS
QNTAAILTTFNEIDMKNVMDLRAKYKDAFEKKYGIKLGFMSFFIKAAVQALKEIAEINAE
ISGDEIIYKHYYDVGVAVGTDKGLVVPVIRGADQMSFAEIELTLVALGKKAREGKLQVSE
MEGATFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRPVAVGNAVEIRPMMYIALSYD
HRIVDGKGAVTFLVKIKNYIEDPNRLVLEV
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattatagaaatcagagcaccaaaaactcttggtggtgaatcagttacagaa
ggtatagtaaaaataaagaagggtattggagaagcagtaaaagtagatgacttgatcttt
gaaattgaaactgacaaaacagcactcgaattaactgcagaagcttcagggcaaataact
gaatttcttataaaagaagatgatgtaataagtcctgatcaattgttagcgaagctttcc
atgggagaagtaaaagaggaagcgagaaaagaagataaaagcgaaagtgctgctaaaaaa
gatgctccatcagctcgtaaaattatggaagaaaatgcaatcagtgcagaaagcgtcaaa
ggaactggcatgggaggcagaataacaaaagcagatgtgataggccatatgaacaaagct
gaacaacctgcaataaaacaatatgaattgccaaaaagtgtagtaaatggagagcaaaga
gaggaacgagtaaaaatgagcaaaataaggcaagtaattgccgctcgtttgaaagcatcg
caaaatactgctgcaatactgaccacgttcaatgaaattgacatgaagaatgtcatggat
ctaagagcaaaatataaggacgcctttgaaaaaaaatatggaataaaacttggttttatg
tcgttttttataaaggcagcggtgcaagcattgaaagaaattgctgaaattaacgctgaa
atctcaggcgatgaaatcatatataaacattactatgacgtaggtgttgctgttggcacc
gataaaggtcttgttgtaccagttattcggggtgccgatcagatgtcatttgcagaaatt
gagttgactttagttgctcttggcaaaaaagctcgtgagggtaaattacaagtatcagaa
atggaaggtgcaacatttaccatctcaaacggtggagtatacggttcacttctttccact
ccgataataaaccctccgcaatctggaatacttggaatgcattcaatacaaaacaggcca
gttgctgttggtaatgcagtagaaatcagacctatgatgtacattgctctctcttacgat
cacagaatagttgacggcaaaggagcagtaactttcctcgttaaaataaaaaattatata
gaagatccaaatagattagttttggaagtgtag

DBGET integrated database retrieval system