KEGG   Wolbachia wMel (Drosophila melanogaster): WD0788Help
Entry
WD0788            CDS       T00160                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    WD0788 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    WD0788 (dapE)
Enzymes [BR:wol01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     WD0788 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
761509..762705
Genome map
AA seq 398 aa AA seqDB search
MKIDPVELTRKLISFESITPEDSGAIEYIATIFKKSGFDCEILEFGDKVKNLYAKYINGV
PNLCFAGHVDVVPPGQLKDWAFGPFKPEVRDGMLYGRGAADMKSGVAAFIAAMVNLIAEK
FQFNGSISALITSAEESMEEYGTKAVLEWMKNKQKKIDFCVVGEPTSSEKLGDTIKIGRR
GSVTFELICHGKQGHVAYPDLADNPIYKVISILSKVKNTTFDHGNKYFQPSHCEVTTIDV
GNNTSNLIPGSATTRFNIRYNNEQTPGGLYKLIDEICSSVTNDYKLSMHSSRDVFLSTPD
RNTDIMLDAISKVTNIDAILSTSGGTSDAAFIKDVCPVIEFGIINKTAHQINECVSVNDI
HKLTAIYKEFIENYFNPTNKILNQVNVVSNISSGPLLA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaccctgtagagctaactaggaaattgatctcttttgagagtataacacca
gaagacagcggggcaatagagtatatagcaacaatcttcaagaagagcggctttgattgt
gagattttagaatttggtgataaagttaaaaatctttatgcgaaatatataaatggagtg
ccaaatttgtgctttgctgggcacgttgatgttgtaccaccgggtcagttaaaagattgg
gcatttggtccatttaaaccagaagtgagggatggaatgctatatggaagaggggccgct
gatatgaaaagcggagtagctgcatttattgctgctatggtaaatttgattgcagagaag
tttcaatttaatggttcaataagtgcattgattaccagtgctgaagaaagcatggaagaa
tatggaacaaaggcagttttggaatggatgaaaaataagcagaaaaagatagatttttgt
gtggttggcgaaccaaccagtagtgagaaattaggtgataccataaaaataggcagaaga
ggttctgtaacatttgaattaatttgccatggaaaacaagggcacgttgcctacccagac
ctagcagacaatccaatatataaggtaatatcgatattgagtaaggtaaaaaatactact
tttgatcatggtaataaatattttcagccttcacattgcgaagttactactatcgatgtt
ggaaataatactagcaatctaatacctggctcagcaactacacgttttaacattcgatat
aacaatgaacaaacaccgggtggcttatataagctgattgatgaaatatgctccagtgta
actaacgattataaactttctatgcatagcagcagggacgttttcctctctactcccgat
agaaatactgatattatgcttgatgcaataagtaaggttaccaacattgatgctatactt
agcacaagtggtggcacatctgacgctgcgtttatcaaagatgtttgtccagtgattgaa
tttggtataatcaacaaaactgcacatcagataaacgaatgcgtatcagtaaacgatata
cacaagttaacagctatatataaggaatttatagaaaattatttcaatcccactaataaa
atattgaatcaggtcaacgtagttagtaatatatctagtggtccattgttagcttag

DBGET integrated database retrieval system