KEGG   Wolbachia wMel (Drosophila melanogaster): WD0803Help
Entry
WD0803            CDS       T00160                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    WD0803
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WD0803
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(776279..776755)
Genome map
AA seq 158 aa AA seqDB search
MIVSNVVDMLYSPEEYKIEHQTIVAAGSNEFQQKIEQVALDIGALMQNASFEKGKSAAKK
CIACHSFEKGGMNKVGPNLWNIVGNKKAHLGNSFNYSKAVLERGGKWGYEELFAFLKNPK
AYIKGTRMAFAGISNPQEIADLVSYLHQLSDSPVALPK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatagttagtaatgtagttgatatgctttacagtccagaagaatataagattgaacac
caaacgatagtagctgctggcagcaatgagttccagcaaaaaatcgagcaagtggcgctt
gatattggagcgctcatgcagaatgctagctttgagaaaggtaaatcagcagcaaaaaaa
tgtatagcctgccatagttttgagaaaggtggaatgaataaagtaggaccaaacttatgg
aacatagttggaaataaaaaggcccatcttggtaactcattcaattactcaaaagcagtg
cttgaaagaggtggaaaatgggggtatgaggagctatttgcctttttaaagaacccaaaa
gcctatataaaaggtacacgtatggcatttgcaggtatttccaatccacaagaaattgca
gatctagttagttatttgcatcaattgagtgatagcccggttgctttgccaaagtag

DBGET integrated database retrieval system