KEGG   Wolbachia wMel (Drosophila melanogaster): WD0883Help
Entry
WD0883            CDS       T00160                                 

Definition
dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    WD0883
Enzymes [BR:wol01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     WD0883
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     WD0883
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
852411..853007
Genome map
AA seq 198 aa AA seqDB search
MLDNLNQYMKVGDIKVSIDSFWPDVILNVLEHYNIAWVNDQKGDLDDNTLKAIASSGCSI
VIMHSLSIPPHSDNIIPSDIDPIDTINNWAERNINRLLALGFDQSSIIIDPGIGFGKSMY
QNIQILRSIETLQNFGCKVLVGHSRKSFISSFSTEPVFNRDLETIATSSVLHNKVDFLRV
HNVRDHMRFFVAQAALQG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtgcttgataatctcaatcagtatatgaaagttggtgacattaaagtcagcattgatagt
ttctggccagatgttattttgaatgttttggagcactacaacattgcctgggtaaacgat
cagaagggagatctagatgataataccttaaaagcgattgctagcagtggatgtagtatc
gttattatgcattcactctccataccaccacatagtgacaacattatcccaagtgacatt
gatccaatcgataccataaataattgggcagaaaggaacattaatagattactagctcta
ggttttgatcaaagctcgatcattattgatcctggtattggttttggcaaatctatgtac
cagaatatccagattttacgcagtatagaaacgttacaaaattttggctgcaaagttctg
gttggccattctagaaagtcatttatttcttctttttctacagaacctgtctttaaccga
gatttagaaacaattgctacatcatctgtattacacaacaaggttgatttccttcgagtg
cataatgtgcgtgatcacatgcgattttttgtagctcaagctgctttacagggatga

DBGET integrated database retrieval system