KEGG   Wolbachia wMel: WD0924Help
Entry
WD0924            CDS       T00160                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
wol  Wolbachia wMel
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:wol00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:wol00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
complement(888460..890034)
Genome map
AA seq 524 aa AA seqDB search
MKLRELLHNIIDVNFDIEIKGVTCNPNRVKEGYLFVCVSAVSFQRVTLESRKPACIQIFP
TESQYHAHDCVDVVIQGTKKDVIPVLDYLDPENLIANEHTKQLHNKNWIPVSATCMTNTP
SFAVLDHPNPQEIYREIVSRFYQFKQPKYVAAVTGTNGKTSVVEFCRQIWQNSGYNAASI
GTLGTCINNDREDNSDNLTTPGADDLYSTLCGINSKNVEQLALEASSHGIDQYRIHGLRF
TAAAFTNFSQDHLDYHKSIDEYFEAKKRLFYEVLPEGETVILNADINEYHALLKIAEKRS
NKVITYGKTGSDITLLEQTPTPNGQYLTIKIGDEIYNMFFPVLGQFQAYNLLCAIGIVTS
SGLNYREISIGKLVSPPGRMEKVQPFAFVDYAHTPSALKQALLSLKWHFNKKIVLVFGCG
GNRDRKKRSEMGKIAQMYADKVIITDDNPRDEDPAKIRHDILLYCPSALEIGDRKEAIEK
GIDIAYNEGMILLVAGKGHEKFQIIGNQTFEFSDVEVIKSKVLS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagagaattactgcataacattattgatgttaactttgatattgaaatcaag
ggcgttacatgtaatcccaatagagtaaaggaaggttatctttttgtttgtgtgtctgcg
gtgtcattccagcgcgtgacgctggaatctagaaaaccagcatgtatccagatttttcct
actgaatcccagtatcacgcacacgactgtgtagacgttgtcatacaaggaaccaaaaaa
gatgtcatcccagtgcttgactacttggatccagaaaatttaattgcaaatgaacacact
aagcaattgcataataaaaactggattccagtgtcagctacttgcatgacaaatactccg
agttttgcagtgcttgaccacccaaaccctcaagaaatatacagagaaatagtcagcagg
ttttatcaattcaaacagcccaaatatgttgctgctgtaactggtacaaatggtaaaact
tcagtagtagaattttgccgccagatctggcaaaactctggctataatgctgcgtctatt
ggaacacttggaacatgcatcaataatgacagagaagataatagcgataatcttaccact
ccaggcgcagatgacctttattccacattatgtggtataaatagtaagaacgtagaacaa
ttagcattagaggcttcaagccatggaattgaccaatacagaattcatggacttaggttc
actgctgcagcttttactaatttctcgcaagatcatttggactatcataagagtatcgat
gagtattttgaggctaagaaaaggttattttatgaggtactaccagagggagaaacagta
attttaaatgcggatataaatgagtaccatgcattgcttaaaatagctgaaaaacgcagc
aacaaagttatcacctatggaaaaacaggttctgatattactttattagagcaaacacca
acccctaatggtcaataccttacaattaaaattggcgatgaaatttataacatgtttttt
ccagttttggggcaatttcaagcatataatctgttgtgtgcaattggtatagttacctcg
tctggactgaattacagagaaatatctataggtaaactcgtttctccaccaggaagaatg
gaaaaagttcaaccttttgcattcgtggattacgcacacactccaagtgcgcttaaacaa
gccctgttgtctttaaaatggcacttcaacaaaaaaatagtcctagtttttggatgcggt
ggcaatcgtgatcggaagaagcgttcagaaatgggtaaaatagcacaaatgtatgcagac
aaagtaataatcacagatgacaatccgcgtgatgaagatcctgcaaaaattcgccacgat
attttgctatattgtcctagtgcactggagataggggacaggaaagaagccatagaaaaa
ggcatagatattgcctataacgagggtatgattctgctggttgcaggaaaaggacatgag
aaatttcaaatcatagggaatcaaacctttgagtttagtgatgttgaggttattaaaagt
aaagttttatcttga

DBGET integrated database retrieval system