KEGG   Wolbachia wMel (Drosophila melanogaster): WD1000Help
Entry
WD1000            CDS       T00160                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WD1000
Enzymes [BR:wol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     WD1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
957905..958612
Genome map
AA seq 235 aa AA seqDB search
MKSILLTRPLLDSFNTRNILRKYGYKVYIEPVFTIKYLNPDISAHEFDVVISTSKNSVKA
FSQICKVDDFPIITVGNSTMQAAKNLGFSDIISADSNVDGLISFIKAHYSSAIKFLYIRG
QEVSCDLKKRLSEEDFNVREVVLYKTIIKRSLTNRCKNLLLDGKIGSVAFFSSQTARVFC
SLVLKSGLSHVMNNTVAYTMSKNIADSLKLIKWKKIITSRLPTGESLIDIINKDC
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctattttattaacgaggcctttattggattcgttcaatacaagaaatatattg
agaaagtatggatacaaagtttatatagaaccagtattcacaataaagtacttaaatcct
gatatatctgcacacgaatttgacgttgtaatatccacaagtaaaaacagtgtaaaggct
tttagtcaaatatgcaaagtggatgactttccgattattacagttggtaattcaaccatg
caggctgcaaaaaatttgggattttctgatataatctcagcagacagcaacgttgatggt
ctgatatcattcataaaagctcactattcaagtgcaataaagttcttatatataagagga
caagaagtatcatgtgacctaaaaaagagattatctgaagaagattttaacgtaagagaa
gttgtactctataaaacaatcattaaaaggagtctaactaataggtgtaaaaatttactg
ttggatggtaaaattggtagtgttgcttttttttcctcacagacagcaagggtattttgt
tcattagttctaaaaagtgggctatctcatgtgatgaataatacagttgcatataccatg
agtaaaaacattgctgatagtttaaagttaatcaagtggaaaaaaattataacatcgagg
ttgcctactggggagagtttaattgatataattaataaggattgctga

DBGET integrated database retrieval system