KEGG   Wolbachia wMel (Drosophila melanogaster): WD1113Help
Entry
WD1113            CDS       T00160                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WD1113 (ruvA)
Enzymes [BR:wol01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     WD1113 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1067056..1067628)
Genome map
AA seq 190 aa AA seqDB search
MIGNLSGIVDEVRSDHIILNVNDVGYMVYLSAKTLNACSIGSRVKLLIETYANNRENVAQ
LYGFISKEEQQCLRLLVKVSGVSYKTAMSILGKLTPEQLFLAIMNEDKVALKMSGLGLKL
INRIITELSGKVSKLEINNNNFHPINEDALSALINLGYEKMKAYDTIKKYRPNLDTKDII
RMALKELSIL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataggaaatctaagcggaatagttgatgaagtgcgcagtgatcacataatcctgaat
gtgaatgatgttggctatatggtgtatctttcagccaaaactttaaatgcatgttccatc
ggaagtagagttaaattacttatcgaaacctatgcaaataacagagaaaatgtcgctcag
ctatatggttttataagcaaagaagaacagcagtgcttgaggttgcttgtcaaagtaagc
ggcgttagctataaaactgcaatgtcaattttgggcaaattaactccagaacagctattt
ttggcaattatgaatgaagataaagtagcactcaagatgagcggacttggcctgaaactc
ataaatcgaatcatcactgaattgagtggcaaagtgagtaaactagaaataaataacaat
aattttcatccaattaatgaagatgccctttcagcattgatcaatcttgggtatgaaaaa
atgaaagcttatgatacgataaaaaaatacaggccaaatctggacactaaggatattatt
cgcatggcgcttaaggagctttcaatactatga

DBGET integrated database retrieval system