KEGG   Wolbachia wMel (Drosophila melanogaster): WD1180Help
Entry
WD1180            CDS       T00160                                 

Gene name
recR
Definition
(RefSeq) recombination protein RecR
  KO
K06187  
recombination protein RecR
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wol00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WD1180 (recR)
DNA repair and recombination proteins [BR:wol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      WD1180 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1128763..1129368)
Genome map
AA seq 201 aa AA seqDB search
MNVNIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKEKVMLPLASLIKELADLIIECEVCGN
LDTKSPCSICTNPKRDTKLLCVVEELGDLWAFEKGNIYSGLYHVLGGRLSAINGIGPKEL
NLDTILKRVTESKIEEIIIAINPTLEGQVTAQYIIELLKNLDVKISRLACGIPMGGEIDY
LDEGTLRIALTSRQEYELNIK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaacgttaacataaagaatctagttcatgctttctctaaattgccaagtttagggcca
tcatcatcacgcaggttagttatacatttactccaaaacaaagaaaaagttatgctacca
cttgcatctttgattaaagagctagcagatcttataatagagtgtgaagtttgcggaaat
ctagatactaagtcaccttgttctatttgtactaacccaaaacgtgacactaagttactg
tgtgtagtagaagaattaggtgatctatgggcgtttgaaaaaggaaatatatattcaggt
ttataccatgttttgggtggcagattgtctgcaataaatggcataggtccaaaagaactc
aaccttgacactattctgaaaagagtgacagagtctaaaattgaagagataattatcgca
attaatccgacattagagggccaagttactgcacaatatataattgaattgctaaaaaat
ttggatgtgaaaatatcacgccttgcttgcggcataccaatgggcggagaaattgactat
cttgatgaaggaacgctgaggatagcacttacttcaagacaagaatatgagttaaatata
aaataa

DBGET integrated database retrieval system