KEGG   Wolbachia wMel (Drosophila melanogaster): WD1210Help
Entry
WD1210            CDS       T00160                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
wol  Wolbachia wMel (Drosophila melanogaster)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wol00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WD1210 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WD1210 (sucC)
   00640 Propanoate metabolism
    WD1210 (sucC)
   00660 C5-Branched dibasic acid metabolism
    WD1210 (sucC)
Enzymes [BR:wol01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     WD1210 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157013..1158164)
Genome map
AA seq 383 aa AA seqDB search
MNIHEYQAKEVFHKFNVPVPKGFVATSAEEVKTQVSQLKSDVFVVKAQIHAGGRGKAGGV
KLAKSVEEAQQFVKDMIGMTLVTHQTGPSGQQVRKVYVEEGSSIKKEYYLSLVIDPKLSR
PIFIFSSEGGMDIEEVAKNSPAKIVKFDIDPATSFDSSKLSSRFHLSPEQIEKISNIAKK
IYDAFIATDASQIEINPLVETNSGDFIALDAKINFDDNALYRHPEIMELRDYDEEVKEEI
EASKYGLSYIKMDGSIGCMVNGAGLAMATMDIIKYYGAEPANFLDVGGGASKETVTEAFK
IILSDSNVKGILVNIFGGIMRCDIIASGIVAAAKEMSIKVPLVVRLSGTNFEEGKKILEE
SGLNIIAADELDEAAQKIVKEVK
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcacgaatatcaagcgaaagaagttttccataaatttaatgtcccagtgcca
aaaggttttgttgctacatctgcagaagaagtaaagactcaagtaagtcaattaaaatct
gacgtgtttgtagttaaagctcaaattcatgcaggtggtaggggtaaagccggtggcgta
aagctagcaaagtcagttgaagaagctcaacagtttgtaaaggacatgattggtatgact
ttagttactcatcaaacagggccaagcgggcagcaagtaagaaaagtgtacgttgaagaa
ggctcaagcattaagaaagagtattatttaagcctggtaatcgacccgaagctcagtagg
ccaatattcatattttcctcagaaggtggaatggacatcgaagaagtggcaaaaaattct
cctgcaaaaattgtgaaatttgatattgatcctgctacaagttttgatagcagcaagtta
agcagccgttttcatttgagtccagaacaaatagaaaagatatcgaacattgcaaaaaaa
atatatgatgcgtttattgcaactgatgcgagccaaattgaaattaatccactggttgaa
acaaattctggagattttattgcgctcgatgcaaaaattaatttcgatgataatgcttta
tatcgtcacccagaaattatggaacttcgtgattatgatgaggaagtgaaagaagagata
gaggcttcaaagtatgggctcagttacatcaaaatggatggcagtattggttgcatggta
aatggtgcaggtcttgctatggcaacaatggatataataaaatactacggagcagagcct
gctaactttttggatgttggtggtggagcgagtaaagaaactgtaactgaagcatttaaa
atcatattgtctgatagcaacgtaaaaggaattctggttaacatatttggtggtataatg
cgttgcgatattatcgcaagtggaattgttgcggctgcaaaagaaatgagcattaaagtt
cctctagtggttagattatcaggtactaattttgaagaaggaaaaaaaattttagaagag
tcaggattaaatattattgctgcagatgagctagatgaagctgcgcaaaagatagtaaaa
gaggtaaaataa

DBGET integrated database retrieval system