KEGG   Wolbachia wOo: wOo_01150Help
Entry
wOo_01150         CDS       T02212                                 

Definition
cytochrome c2
Orthology
K08738  
cytochrome c
Organism
woo  Wolbachia wOo
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:woo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:woo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(96527..97054)
Genome map
AA seq 175 aa AA seqDB search
MELNKVAASILFSGLMIMIVSNIVDMLYSPEEYKIEHQTIVAAGDSESQQKIEQVALDIQ
ALMQNASFEKGKLAAKKCVACHSFEKGGLNKVGPNLWNVVGNKKAHLGDSFNYSKAMFEK
GGRWGYEELFVFLKNPKAYIKGTRMAFAGISNPQEIADLVSYLRGLSDNPIDLPK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaataaagttgcagcatcgattcttttttctgggctaatgattatgatagtc
agtaatatagttgatatgctttacagtccagaagaatataaaattgaacaccaaacaata
gtagctgctggtgacagtgaatctcagcaaaagattgaacaagtagcgcttgatattcaa
gcgctcatgcagaatgctagcttcgagaagggtaagttagctgcaaagaagtgtgtagct
tgtcatagttttgaaaaaggtggacttaataaggtagggccaaacttgtggaatgtagtt
ggaaataaaaaagcacaccttggtgattcatttaattactcaaaagcaatgttcgaaaag
ggtggaaggtgggggtatgaggagctgtttgtttttttaaagaatccgaaagcctatata
aaaggtacgcgcatggcatttgcaggtatttctaacccacaagaaatagctgacttggtc
agctatttacggggattaagtgataacccgattgatttaccaaaataa

DBGET integrated database retrieval system