KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_02620Help
Entry
wOo_02620         CDS       T02212                                 

Definition
dihydrolipoamide acyltransferase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wOo_02620
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wOo_02620
  Amino acid metabolism
   00310 Lysine degradation
    wOo_02620
Enzymes [BR:woo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     wOo_02620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(229182..230330)
Genome map
AA seq 382 aa AA seqDB search
MGKIIEIRAPEILGGESVTEGIVKIKRNIGEAVKVDDLIFEVETDKAALELTAEASGEIT
EFLVKENDIISPGQLLARLSIREVQEDKSEIPVIRDAPSARKIMEENAISAKSVKGTGMG
GRITKADVAHISKTEQPAIYKLPESVMSGERREKRIKMSKIRQVIAARLKASQNTAATLT
TFNEIDMQSVMNLRAKYKEIFEKKYGIKLGFMSFFIKAAVQALKEIPEINAEILGDEIIY
KHYYDIGVAVGTDKGLVVPVIRSADQISFAEIELTLAALGKRAREGKLQVSEMEGATFTI
SNGGIYGSLFSTPIINPPQSGILGMHSIQNRPVVVGNSIEIRPIMYIALSYDHKIVDGKG
AVTFLVKIKNYIEDPNRLILGV
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaaattatagaaatcagggcgccagagattcttggtggtgaatcagttacggaa
ggtatagtcaaaataaaaagaaatattggtgaagcagtaaaagtagatgacttaatcttt
gaagttgaaactgacaaagcagcacttgaattaactgcagaagcttcaggggaaataact
gaatttcttgtaaaagaaaatgatataataagtccaggtcaattattagcaaggctttct
ataagggaggtgcaagaagataaaagtgaaatccctgttataagagacgctccatcagct
cgtaaaattatggaagagaatgcaatcagtgcaaaaagtgtcaaaggaactgggatggga
ggcagaataacgaaagcagatgtagcccatataagcaaaactgaacagcctgcaatatat
aaactgccagaaagtgtaatgagtggagagagaagagaaaagcgaataaaaatgagtaag
ataaggcaagtaattgctgctcgtttgaaggcttcacaaaacactgctgcaacactgact
acatttaatgagattgacatgcaaagcgtaatgaatctaagagcaaaatataaagaaatt
ttcgaaaagaaatatggaataaagcttggtttcatgtccttttttataaaggctgcggtg
caagctctgaaagaaattcctgaaattaacgctgaaattttaggcgatgaaattatatat
aaacattattatgacataggtgttgctgttggcactgataagggtcttgttgtgccagtt
attcggagtgctgatcagatatcatttgcggaaattgagttaactttagctgcccttggt
aaaagagcccgcgaaggtaagttacaggtgtcagaaatggaaggtgcaacatttaccatt
tcaaacggtgggatatatggttcacttttttctactccgataataaatcctccacagtct
ggtatacttgggatgcattcaatacaaaacaggccagttgttgtgggtaactcaattgaa
attaggcctataatgtacattgccctttcttacgatcacaaaatagttgatggcaaagga
gcagtaactttccttgttaaaataaaaaattatatagaagatccaaacagattaattttg
ggagtgtga

DBGET integrated database retrieval system