KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_02910Help
Entry
wOo_02910         CDS       T02212                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00010  Glycolysis / Gluconeogenesis
woo00020  Citrate cycle (TCA cycle)
woo00620  Pyruvate metabolism
woo01100  Metabolic pathways
woo01110  Biosynthesis of secondary metabolites
woo01120  Microbial metabolism in diverse environments
woo01130  Biosynthesis of antibiotics
woo01200  Carbon metabolism
Module
woo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wOo_02910
   00020 Citrate cycle (TCA cycle)
    wOo_02910
   00620 Pyruvate metabolism
    wOo_02910
Enzymes [BR:woo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     wOo_02910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CCF78045
UniProt: I7JEF4
Position
247162..248412
Genome map
AA seq 416 aa AA seqDB search
MPIEILMPVLSPTMSKTGGKIVKWYKKEQDKVEVGDIIAEIETDKAIMELESVDRGVLAK
ILVSEGVSGVPVNQPIAIMLEEEEDWNALDNYVSASVTNIKPEKEIETNLPTSSQCLTLR
PRKEEDTNKVVVEDRIKISPLAKKIAQSEGVDITHLKGTGPHGRIVKADVLELLDDSTQI
ESRKKLSEDIIIEVSNMRRTIAERLVESKQNIPHFYLTVDCQVDNLISLKNKINSANENN
KVTINDLIIKAAAFSIKKFPDINSSWIDNKIVRYSNIDISVAVALEDGLITPIVKDADKK
GILSISREVKTLVNRAKSGKLRPEEFQGKGVTISNLGMFGIKAFSAIINPPQSCIMAVGA
SKKQPIIINEKVEIAEIMIVTLSADHRTVDGTMGAKFLNTFKHYIENPLTILIEVT
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgcccatagaaatattaatgcctgttctctcaccgacaatgagtaaaacaggaggaaaa
atcgtaaaatggtacaaaaaagaacaagacaaagtagaagtaggtgatataattgctgaa
atagagaccgacaaagctataatggagcttgaatctgtagatagaggagttttagcaaaa
attttagtgtcagaaggagtaagcggtgtacctgtgaatcaaccgatagctataatgctg
gaagaggaggaagattggaatgcacttgataactacgtttcagcttctgttactaatatc
aaacctgaaaaggaaattgaaactaatcttccaacatcatcccagtgcttaacactaaga
cctagaaaagaagaagataccaacaaggtagtagtagaagatagaataaaaataagccca
ttagctaaaaaaatagctcaaagtgaaggtgttgacataacgcacctaaaaggtacaggc
ccgcatggtcgtatcgttaaagctgatgtattagaacttttagatgatagtacacaaatt
gaaagccgtaaaaagttaagtgaagacattataatcgaagtaagtaacatgcgccggacg
atagcagagcgcttggttgaatctaagcagaatattccacatttttatttaactgtagac
tgccaggttgacaacctcatatcgctcaaaaataagatcaactcagcaaacgaaaacaat
aaagtaacaattaatgatttaattattaaagctgcggcttttagcataaaaaaatttcct
gacataaattcctcgtggatagataacaagatagtaagatattcaaatatagatatctca
gttgctgtagcacttgaagatggcctaattactcctatagtgaaagatgctgacaaaaaa
ggtattttatctatatcaagagaagtgaaaactttagtaaacagagcgaaatccggaaaa
ttaagacctgaagaatttcaaggaaaaggggtcactatctccaacttagggatgtttggt
ataaaagctttcagtgctattattaatccgccgcagtcttgcattatggccgttggtgca
tccaaaaagcaaccgattattataaatgaaaaagtagagattgcagagataatgatagta
acactttcagctgaccatagaacagttgatggaacaatgggagcaaaatttttaaatacc
tttaagcactatatagagaatcctctaacaatacttattgaagttacataa

DBGET integrated database retrieval system