KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_03240Help
Entry
wOo_03240         CDS       T02212                                 

Definition
UDP-N-acetylglucosamine enolpyruvyl transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    wOo_03240
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    wOo_03240
Enzymes [BR:woo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     wOo_03240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
272746..274026
Genome map
AA seq 426 aa AA seqDB search
MHKILVKSNCKPLVGEIKINGSKNAILPIMAASLLSSSSVTLHNVPNLIDVHLMSELLEK
LGAKVNFMYNKGYKANHIFEIDCSNINNYIVSHETASKLRASFLMLGPILSRFGKITTVF
PGGCNIGKRPVDMHIKALEAMGAEIEIDGCNIIVAVKGKLKGKEITFEKTSVGATENIIM
AATLAEGVTTINNAATEPEIVDLIEFLKKMGANIKINNKKITITGVEVLNGCVHKIILDR
IEAGTYALAAIITGGELTLEGINLSDIRCIANELETIGAKIELLDQGITVSRKSCFIKSI
NVATDSYPNFPSDMQPQLMSTMCIADGTSVIEENIFENRFTHTSELRKLGANINIKKNKA
TINGIKSLYGANNLYATDLRSTAALILASLVARGETTISNSDHLWRGYEVMHEKLNSCGA
DISILS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatattagtaaagagtaattgtaagcccttggttggagaaattaagattaac
ggttcaaagaatgctattttaccgataatggcggcaagcctattaagcagttcttcagta
actttacataacgtacctaatctaattgacgtacatctgatgtctgaactgctcgaaaag
cttggagcgaaggtaaactttatgtacaataaaggctataaagcaaaccatatttttgaa
attgattgtagcaatatcaataattacatagtatcacatgaaactgcaagtaagctacga
gcatcttttctaatgctgggtccaattctcagtagatttggtaaaattacaacggtcttc
cctggtggatgtaatattggaaaacgtcccgttgatatgcacatcaaagcattagaagca
atgggagctgaaattgaaattgatggttgtaatataattgtagcagtgaaaggaaaacta
aaagggaaagagattacattcgagaagacaagcgttggcgcaacagaaaatataataatg
gcggcaacccttgcagaaggggtgacaacaataaacaatgctgcaacagagccagaaatt
gtggatttaatagaatttctaaagaaaatgggagctaatattaaaatcaacaataaaaaa
attacaataacaggagttgaggtattaaatggatgtgtccataaaataatattagatcgt
atagaagctggtacatatgcactagctgctataataactggtggtgagttgacgttagaa
ggaataaatctatctgatataagatgcattgcaaatgagttggaaaccataggagctaag
atcgaattacttgatcaaggtattactgtttctagaaaaagctgttttattaaatctatc
aacgtcgcaacagattcgtaccctaattttcccagtgacatgcaaccacaacttatgtcc
acaatgtgcattgctgatggaacatctgtcattgaagaaaacatttttgagaacaggttc
acacatacaagtgagttgagaaaattaggtgctaacataaacataaagaaaaacaaagct
actataaacggaataaaaagcttatacggagctaataatctatatgctactgacctgagg
tcaacagcggctctgatactcgcttctttggtagctagaggagaaactacgataagtaat
tcagatcacttatggaggggatatgaagtaatgcatgaaaaactcaattcatgcggagct
gatatttccattttatcttaa

DBGET integrated database retrieval system