KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_04050Help
Entry
wOo_04050         CDS       T02212                                 

Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00240  Pyrimidine metabolism
woo00250  Alanine, aspartate and glutamate metabolism
woo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    wOo_04050
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    wOo_04050
Enzymes [BR:woo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     wOo_04050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: CCF78111
UniProt: I7ITP2
Position
complement(346415..347311)
Genome map
AA seq 298 aa AA seqDB search
MVNKKNLLSVRDLTINDVENIVKLADQYLKNKAAGCHILENKIVINLFFEDSTRTLASFE
IAAKSLGANVVTLPIKSSSINKGEDLKDMVKTLNAMNPDYIIIRQKNSGIVNVLAQYINC
SLINAGNGSSEHPTQALADCFVISSYKNQIRDLKIVICGDILHSRVARSNIRLLKMFGAK
ICLIAPPTLICRYFPEVDSIYYSLIEGIKDADVIMLLRLQKERMDNGCFISSEREYFYLY
GLDSQKLLYAKPDAIIMHPGPINRGVEIGSDVVDYVILQQVEFGLAIRKAVLHYYSSC
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggttaataagaagaatttgctgagtgtacgggatcttacaatcaatgatgtagaaaat
atagttaagttagccgatcaatacctgaaaaataaagctgcaggttgccatattttagaa
aataaaatagtaataaatttattctttgaggactcaacacgtacacttgcatcctttgaa
atagcagcaaaaagccttggagcaaatgttgtaaccttgccaataaagtcttcttctatt
aataagggagaagatttaaaggatatggtaaaaacattaaatgcaatgaatcctgattac
ataataattagacagaaaaatagtggtattgttaatgtgctagctcagtacattaactgt
tcactaatcaatgcgggtaatgggagtagtgaacacccaactcaggctcttgctgattgt
tttgttatcagcagttataaaaatcagataagagatcttaaaattgtaatatgtggagat
attttacatagcagagttgcaagatcgaatataagactgttaaaaatgtttggggcgaag
atatgcttgattgcaccgccaactttgatttgtagatattttcctgaggtagattcaatc
tattattcattgattgaaggtataaaagatgctgatgtaattatgcttttaaggttgcag
aaggaacgcatggataatggttgttttatttcttcagagagagagtatttttatttatat
ggccttgattcacagaaattgttgtatgcaaaaccagatgcaattatcatgcacccaggg
ccgataaatagaggggttgaaattggtagtgatgtagtagattatgttattttacagcag
gtagagttcggattagcgatacgtaaggcagtgctacattattatagttcttgctaa

DBGET integrated database retrieval system