KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_04840Help
Entry
wOo_04840         CDS       T02212                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wOo_04840
   01230 Biosynthesis of amino acids
    wOo_04840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wOo_04840
   00051 Fructose and mannose metabolism
    wOo_04840
   00562 Inositol phosphate metabolism
    wOo_04840
Enzymes [BR:woo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     wOo_04840
Exosome [BR:woo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   wOo_04840
  Exosomal proteins of bladder cancer cells
   wOo_04840
  Exosomal proteins of melanoma cells
   wOo_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415866..416585
Genome map
AA seq 239 aa AA seqDB search
MSFLIVANWKMNGTRSLFVDFINKLNNKSNGITSKIVVCPPFTSLPDAIELSDNINIGAQ
NCHYKKYGSYTGEVSARMLKELECTYVILGHSERTNETDSEIKLKSEIAIESGLHPIICV
GENAENYKSRRTKEVIVYQCKNRLLIHSEYTVAYEPLWAIGTGYIPSNDEIAEVIEVIKS
CIGEKQVIYGGSVSLENIGSLLRISNLSGVLIGSASLDFDYFYKIIQQVEETYNSEISN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttaattgtagcaaattggaaaatgaatggaacgcggtctttgtttgttgac
tttataaataaacttaacaataagagcaatggaattacctctaagatcgtggtttgtcca
ccttttacatcattgccagatgccatagagctaagcgataatattaatataggagcacag
aattgccattataaaaaatatggatcttacacaggtgaggttagtgcaaggatgttaaaa
gaattagaatgtacttatgtaatacttggacattctgaaagaaccaacgaaacagatagt
gaaataaaacttaagtcagaaatagcaatagagtctggtctacacccaattatttgtgta
ggtgaaaatgcagaaaattataagagtaggagaacaaaggaagtaatagtatatcaatgc
aaaaaccgcttattgatacatagtgaatatactgtagcatatgaaccgttgtgggcaata
ggtacagggtatataccaagcaatgatgaaattgctgaggtaatagaggtaataaaatcc
tgtattggtgaaaaacaggttatatatggtggttcagttagtttggaaaatataggaagt
ttgcttaggatctcaaatttatcaggagttttgattggtagtgcaagcctagattttgat
tacttttataaaattatacaacaagttgaagaaacctacaattctgaaatcagtaattag

DBGET integrated database retrieval system