KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_04840Help
Entry
wOo_04840         CDS       T02212                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wOo_04840
   01230 Biosynthesis of amino acids
    wOo_04840
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wOo_04840
   00051 Fructose and mannose metabolism
    wOo_04840
   00562 Inositol phosphate metabolism
    wOo_04840
Enzymes [BR:woo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     wOo_04840
Exosome [BR:woo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   wOo_04840
  Exosomal proteins of bladder cancer cells
   wOo_04840
  Exosomal proteins of melanoma cells
   wOo_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
415866..416585
Genome map
AA seq 239 aa AA seqDB search
MSFLIVANWKMNGTRSLFVDFINKLNNKSNGITSKIVVCPPFTSLPDAIELSDNINIGAQ
NCHYKKYGSYTGEVSARMLKELECTYVILGHSERTNETDSEIKLKSEIAIESGLHPIICV
GENAENYKSRRTKEVIVYQCKNRLLIHSEYTVAYEPLWAIGTGYIPSNDEIAEVIEVIKS
CIGEKQVIYGGSVSLENIGSLLRISNLSGVLIGSASLDFDYFYKIIQQVEETYNSEISN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttaattgtagcaaattggaaaatgaatggaacgcggtctttgtttgttgac
tttataaataaacttaacaataagagcaatggaattacctctaagatcgtggtttgtcca
ccttttacatcattgccagatgccatagagctaagcgataatattaatataggagcacag
aattgccattataaaaaatatggatcttacacaggtgaggttagtgcaaggatgttaaaa
gaattagaatgtacttatgtaatacttggacattctgaaagaaccaacgaaacagatagt
gaaataaaacttaagtcagaaatagcaatagagtctggtctacacccaattatttgtgta
ggtgaaaatgcagaaaattataagagtaggagaacaaaggaagtaatagtatatcaatgc
aaaaaccgcttattgatacatagtgaatatactgtagcatatgaaccgttgtgggcaata
ggtacagggtatataccaagcaatgatgaaattgctgaggtaatagaggtaataaaatcc
tgtattggtgaaaaacaggttatatatggtggttcagttagtttggaaaatataggaagt
ttgcttaggatctcaaatttatcaggagttttgattggtagtgcaagcctagattttgat
tacttttataaaattatacaacaagttgaagaaacctacaattctgaaatcagtaattag

DBGET integrated database retrieval system