KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_04840Help
Entry
wOo_04840         CDS       T02212                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00010  Glycolysis / Gluconeogenesis
woo00051  Fructose and mannose metabolism
woo00562  Inositol phosphate metabolism
woo01100  Metabolic pathways
woo01110  Biosynthesis of secondary metabolites
woo01120  Microbial metabolism in diverse environments
woo01130  Biosynthesis of antibiotics
woo01200  Carbon metabolism
woo01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    wOo_04840
   00051 Fructose and mannose metabolism
    wOo_04840
   00562 Inositol phosphate metabolism
    wOo_04840
Enzymes [BR:woo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     wOo_04840
Exosome [BR:woo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   wOo_04840
  Exosomal proteins of bladder cancer cells
   wOo_04840
  Exosomal proteins of melanoma cells
   wOo_04840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: CCF78156
UniProt: I7ITQ8
Position
415866..416585
Genome map
AA seq 239 aa AA seqDB search
MSFLIVANWKMNGTRSLFVDFINKLNNKSNGITSKIVVCPPFTSLPDAIELSDNINIGAQ
NCHYKKYGSYTGEVSARMLKELECTYVILGHSERTNETDSEIKLKSEIAIESGLHPIICV
GENAENYKSRRTKEVIVYQCKNRLLIHSEYTVAYEPLWAIGTGYIPSNDEIAEVIEVIKS
CIGEKQVIYGGSVSLENIGSLLRISNLSGVLIGSASLDFDYFYKIIQQVEETYNSEISN
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttaattgtagcaaattggaaaatgaatggaacgcggtctttgtttgttgac
tttataaataaacttaacaataagagcaatggaattacctctaagatcgtggtttgtcca
ccttttacatcattgccagatgccatagagctaagcgataatattaatataggagcacag
aattgccattataaaaaatatggatcttacacaggtgaggttagtgcaaggatgttaaaa
gaattagaatgtacttatgtaatacttggacattctgaaagaaccaacgaaacagatagt
gaaataaaacttaagtcagaaatagcaatagagtctggtctacacccaattatttgtgta
ggtgaaaatgcagaaaattataagagtaggagaacaaaggaagtaatagtatatcaatgc
aaaaaccgcttattgatacatagtgaatatactgtagcatatgaaccgttgtgggcaata
ggtacagggtatataccaagcaatgatgaaattgctgaggtaatagaggtaataaaatcc
tgtattggtgaaaaacaggttatatatggtggttcagttagtttggaaaatataggaagt
ttgcttaggatctcaaatttatcaggagttttgattggtagtgcaagcctagattttgat
tacttttataaaattatacaacaagttgaagaaacctacaattctgaaatcagtaattag

DBGET integrated database retrieval system