KEGG   Wolbachia wOo: wOo_06380Help
Entry
wOo_06380         CDS       T02212                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
woo  Wolbachia wOo
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:woo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(570908..571621)
Genome map
AA seq 237 aa AA seqDB search
MRMKSILLTRPLLDSLNTRNALKKHGYKVYIEPVFTIKHLQPDISAYKFDVVISTSKNSV
KAFSQICKIGDLPIITVGNSTMQTAKDLGFSDIVSADSNVDGLISFIKNHYSIAVKFLYI
RGQEVSCDLKKRLSEEGFCVREVILYKTIVKKSLTNRCKNLLSGNKINGVVFFSSQTARV
FCSLVLKSGLSHTISNIIAYTMSKNIADSLKSIKWKKIITSRLPTRESLINIINKNY
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgaagtctattttattaacgaggcctttattagattcactaaacacaagaaat
gcactgaaaaaacatggatataaagtatatatagaaccagtattcacaataaagcattta
cagcctgacatatctgcatataaatttgacgtagtaatatccacaagcaagaacagtgta
aaggcatttagtcagatatgtaagataggtgatcttccaatcattactgttggcaattca
acgatgcaaactgcaaaggatttaggattttctgatattgtatcagcagatagtaatgtt
gatgggttgatatcgttcataaaaaatcactattcaatagcagtgaagttcttgtacata
agaggacaagaggtatcatgcgatttaaaaaaaaggttatctgaagaaggtttttgtgta
agagaagttatactctacaaaacaatcgttaaaaaaagtttaactaacaggtgcaaaaac
ttgttatcgggtaataaaattaatggtgttgtttttttttcttcacagacagcgagagta
ttttgttctttagttctaaaaagtggtttatctcacacaataagcaatataattgcatat
actatgagtaaaaatatcgctgacagtttaaagtcgatcaaatggaaaaaaattataaca
tcgaggttacctactagggaaagtttaattaatataattaataagaattactga

DBGET integrated database retrieval system