KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_06700Help
Entry
wOo_06700         CDS       T02212                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    wOo_06700
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    wOo_06700
Enzymes [BR:woo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     wOo_06700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(600235..601629)
Genome map
AA seq 464 aa AA seqDB search
MMKESLAKTNVVQVEDKKAAKGFLKILGEVTDAVRSWIGNIGTDLDNSRDINSLVSKMNE
CLNPKGGEVSARKNTVSLGNLYLSLSEKGKIRFLQTLAEKFNTSKAEIDKKIKGYKENKN
PELDYKFEQDLIKVLESPRSKILKQFISLPEGLKFIVDMRSDVLKLRNQYKELNRLESEL
KSILLSWVDVDLLDLRQITWGSPASLLEKLIKYEAVHKISSWSDLKNRLDSDRLCFTFFH
YKIPNEPLIFVEVALMNKIADSIQYLLDESTPSSDPSNANTAIFYSISNTQTGLSGISLG
NFLIKRVVEKLSQEFKSIKTYATLSPIPGFTKWLKGNLRQDTILLGKLGIKQSITKILES
IEQLKTNTEYEKQYLLKLCAYYLLKVKNNNGNAYDQVAHFHLSNGASIKQLNWMADTSEK
GISQSAGMMVNYLYELSKIDNNHENYMINKMISCAKQVSSILKG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaatcattagcaaaaactaatgtagtgcaagttgaagataaaaaagcagca
aaaggctttttaaaaatactaggtgaagtaacagatgctgtaaggtcgtggattggtaac
attggcactgatttagataatagtcgtgatattaatagtctagtttcgaagatgaatgag
tgcttaaatccaaaaggaggagaagtctcagcacgtaagaatactgtatctctcggtaac
ttgtatttaagtttatcagagaaaggtaaaataaggtttttacaaactctggcagagaaa
tttaatacaagcaaggcagaaatagataagaaaataaaaggatacaaggaaaataagaat
cctgagttagactataaatttgaacaggacttgataaaagtccttgaatcaccgcgttct
aaaatattgaagcaatttatttctttaccagaaggcctcaagtttattgttgatatgcgt
tctgatgtacttaagttaagaaatcaatataaagagcttaaccgattagaaagtgaatta
aaaagcatacttctctcctgggttgacgtcgatttacttgatcttcgtcaaattacctgg
ggttcacctgcatcattattagaaaaacttataaagtatgaagctgtgcataaaatttct
tcatggagtgatctaaaaaatagactagactctgaccgtctctgttttaccttttttcat
tataaaataccaaatgaacctctgattttcgtagaggttgcattaatgaataagattgca
gatagcattcaatacctcttagatgaatcaacgccctcaagtgatccaagcaatgcaaat
actgctatattctattcaatatcaaatacccaaacaggattgtctggaattagcttaggt
aatttcttgatcaaaagggttgtagaaaagctatcacaggagtttaaaagtataaaaaca
tacgcaacactttctccgatacctggctttacaaaatggctaaaaggaaatctaaggcag
gatactattttattaggaaaattaggtataaaacagtctattacaaagattttagaaagc
atagaacaattaaaaactaacactgaatacgaaaaacaatacttgctgaaactttgtgca
tattacttactaaaggttaaaaacaataatggcaatgcctatgaccaagtggcacacttt
catttaagcaatggtgcatcaataaagcaactaaactggatggcagatacttctgaaaag
ggcattagtcaatctgctggaatgatggtgaattacttatatgaattgtctaaaatagat
aataatcacgaaaattatatgattaataaaatgatttcttgcgcaaagcaggtatcatct
atattaaaaggataa

DBGET integrated database retrieval system