KEGG   Wolbachia wOo: wOo_06700Help
Entry
wOo_06700         CDS       T02212                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
woo  Wolbachia wOo
Pathway
Propanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:woo00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(600235..601629)
Genome map
AA seq 464 aa AA seqDB search
MMKESLAKTNVVQVEDKKAAKGFLKILGEVTDAVRSWIGNIGTDLDNSRDINSLVSKMNE
CLNPKGGEVSARKNTVSLGNLYLSLSEKGKIRFLQTLAEKFNTSKAEIDKKIKGYKENKN
PELDYKFEQDLIKVLESPRSKILKQFISLPEGLKFIVDMRSDVLKLRNQYKELNRLESEL
KSILLSWVDVDLLDLRQITWGSPASLLEKLIKYEAVHKISSWSDLKNRLDSDRLCFTFFH
YKIPNEPLIFVEVALMNKIADSIQYLLDESTPSSDPSNANTAIFYSISNTQTGLSGISLG
NFLIKRVVEKLSQEFKSIKTYATLSPIPGFTKWLKGNLRQDTILLGKLGIKQSITKILES
IEQLKTNTEYEKQYLLKLCAYYLLKVKNNNGNAYDQVAHFHLSNGASIKQLNWMADTSEK
GISQSAGMMVNYLYELSKIDNNHENYMINKMISCAKQVSSILKG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaatcattagcaaaaactaatgtagtgcaagttgaagataaaaaagcagca
aaaggctttttaaaaatactaggtgaagtaacagatgctgtaaggtcgtggattggtaac
attggcactgatttagataatagtcgtgatattaatagtctagtttcgaagatgaatgag
tgcttaaatccaaaaggaggagaagtctcagcacgtaagaatactgtatctctcggtaac
ttgtatttaagtttatcagagaaaggtaaaataaggtttttacaaactctggcagagaaa
tttaatacaagcaaggcagaaatagataagaaaataaaaggatacaaggaaaataagaat
cctgagttagactataaatttgaacaggacttgataaaagtccttgaatcaccgcgttct
aaaatattgaagcaatttatttctttaccagaaggcctcaagtttattgttgatatgcgt
tctgatgtacttaagttaagaaatcaatataaagagcttaaccgattagaaagtgaatta
aaaagcatacttctctcctgggttgacgtcgatttacttgatcttcgtcaaattacctgg
ggttcacctgcatcattattagaaaaacttataaagtatgaagctgtgcataaaatttct
tcatggagtgatctaaaaaatagactagactctgaccgtctctgttttaccttttttcat
tataaaataccaaatgaacctctgattttcgtagaggttgcattaatgaataagattgca
gatagcattcaatacctcttagatgaatcaacgccctcaagtgatccaagcaatgcaaat
actgctatattctattcaatatcaaatacccaaacaggattgtctggaattagcttaggt
aatttcttgatcaaaagggttgtagaaaagctatcacaggagtttaaaagtataaaaaca
tacgcaacactttctccgatacctggctttacaaaatggctaaaaggaaatctaaggcag
gatactattttattaggaaaattaggtataaaacagtctattacaaagattttagaaagc
atagaacaattaaaaactaacactgaatacgaaaaacaatacttgctgaaactttgtgca
tattacttactaaaggttaaaaacaataatggcaatgcctatgaccaagtggcacacttt
catttaagcaatggtgcatcaataaagcaactaaactggatggcagatacttctgaaaag
ggcattagtcaatctgctggaatgatggtgaattacttatatgaattgtctaaaatagat
aataatcacgaaaattatatgattaataaaatgatttcttgcgcaaagcaggtatcatct
atattaaaaggataa

DBGET integrated database retrieval system