KEGG   Wolbachia wOo: wOo_06880Help
Entry
wOo_06880         CDS       T02212                                 

Definition
dihydropteroate synthase
Orthology
K13941  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:2.7.6.3 2.5.1.15]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    wOo_06880
Enzymes [BR:woo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     wOo_06880
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     wOo_06880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(615688..616986)
Genome map
AA seq 432 aa AA seqDB search
MIYISIGSNLRNRLSNLQKATQLLKKRYLKDLKSSIILETKAILPNGAPDEWNKPFLNMV
VYGSCLVSPEELLKGLKQIEYDIGRTQVHEKWAPRVIDLDILLWDNLILNTPYLTIPHPE
LMNRPFLLHLMAMLSPMDNIPVVSKTFDTIAYNNLNTKDCFLKSFTLSPKFVGIVNITPD
SFSDGGLYYDSDQATKQALKLISDGASIVDLGAQSTRPGSSIQPSKVEYARLKPVLDNLS
HYMKANDIKVSIDSFWPDVILNVLEHYRVTWINDVKGNLDDNTLKTIASSGCSIVIMHSL
SIPSHKDNIIPSDTDPINTINRWAEKNINKLLTFGFNENSIIIDPGIGFGKSLYQNIWLL
RNIETLQSFGCKVLVGHSRKSFISSFSTEPVFNRDLETISISSALYNKVDFLRVHNVRDH
MQFFVAQAALQK
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatttatatatctattggctcaaatttaaggaatcgcctctctaatttacaaaaggct
actcagctactaaaaaagcgctatttaaaagatttaaaatcttcaattattttagaaacc
aaggccattttaccaaatggtgctccagatgagtggaacaagccatttctcaatatggtt
gtatatggaagttgtcttgtttctcctgaagagctactaaaaggactcaagcaaatcgaa
tatgacattggtcgtacacaggtccacgaaaaatgggcacctcgcgttattgatttagat
attttgttatgggataacctaatactcaatacaccgtatcttacaattcctcatccagaa
ttgatgaataggccatttttgcttcacttaatggcaatgctgagtcctatggataatatt
ccagtagttagcaaaacgtttgatactattgcttacaacaaccttaataccaaggattgc
tttttaaaaagctttacgctttcaccaaaatttgtaggaattgttaacattactcccgat
tcattttcagatggtggcctttattatgattctgatcaagcaactaaacaggcactaaaa
ttgatatcagatggtgcaagcatagttgatcttggtgctcaatcaacaaggcctggatct
tctatacagccttcgaaagtagaatatgcacgcttaaagccggtacttgataatctcagt
cactatatgaaagctaatgatattaaagttagcattgatagtttctggccggatgttatt
ttaaatgttttagaacactatagagttacttggataaatgatgtgaaaggaaatctagat
gataataccttaaaaacaattgcaagtagcggatgtagtatagttatcatgcattcactc
tctataccatcacacaaggataatattattccaagtgatactgaccccatcaacaccata
aatcgttgggcagaaaagaacattaacaagttacttacctttggttttaatgaaaattcg
ataatcattgatcctggtattggctttggaaaatctctatatcaaaatatctggctgtta
cggaatatagaaacattgcaaagttttggctgcaaagtcctagtaggtcattccagaaaa
tcattcatttcttctttttccacagagcctgtctttaatcgagatttagaaacaatttct
atatcatctgcattatacaacaaagttgatttccttcgcgtacataatgtacgcgatcac
atgcagttctttgtagctcaagctgccttacaaaaatga

DBGET integrated database retrieval system