KEGG   Wolbachia wOo: wOo_08850Help
Entry
wOo_08850         CDS       T02212                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    wOo_08850
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    wOo_08850
Enzymes [BR:woo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     wOo_08850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(802960..804357)
Genome map
AA seq 465 aa AA seqDB search
MKLRELLYNIIDVTFDIEIKGVTCNPKRVKEGYLFVCISKEHEKCISDIKTSAIIANFMV
HDSRIYILHPNPQEIYSKIVSRFYQFKQPKYAAAVTGTNGKTSVIEFCCQIWQNAGYNAA
SIGTLGMYTNNERKANHNSLTTPDADDFYATLCDINSKGIEYLALEASSHGIDQYRIHGL
ELTAAAFTNLSQDHLDYHQNISKYFKAKKRLFHEVLSKEKTVILNANTDKYYALLKIAKK
RGNKVITYGEKSSNITLIKQVPALNGQYLTIRISNEVYNVFFPVFGQFQACNLMCAIGIA
ISSGLDYKKMCIDKLISPPGRMEKVKPFVFVDYAHTPSALKQAILSLKWHFNKKIVLVFG
CGGNRDQAKRAEMGKIAQMYAEKVIITNDNPRDENPTEIRRDILLHCPDAVEVEDRKEAI
EKGIDISYNKGMILLIAGKGHERFQIINGQALEFSDVEVVRNYAS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgagggagttactgtataacattattgatgttacttttgatattgaaatcaaa
ggtgtcacgtgtaaccctaagagagtcaaagaaggctacctttttgtttgtatatcaaag
gaacatgaaaagtgtataagtgatataaaaacttcagctataatagcaaattttatggta
catgactctcgaatttatattcttcacccaaatcctcaagaaatatatagcaaaatagtt
agcagattttatcaattcaaacagcctaaatatgctgctgctgtaacaggcacgaatggc
aaaacttcagtgatagagttttgctgtcagatctggcaaaatgctggctataatgcggcg
tctattggaacacttggaatgtataccaataatgaaaggaaagctaatcataatagcctt
accactccagatgcagatgacttttatgcaacactatgtgatataaatagtaaaggtata
gagtatttagcattagaggcttcaagtcatggaattgatcagtacagaattcatggactt
gagttaactgctgcggcttttacaaatctctcacaagatcatttagattatcatcagaac
atcagcaaatattttaaggctaagaaaaggttatttcatgaggtactatcaaaagaaaaa
acagtaattttaaatgcaaatacagataagtactatgcattacttaagatagctaaaaaa
cgtggcaacaaagttataacttatggggaaaaaagctctaacattactttaataaagcaa
gtaccagcactaaatggccaatacctaacgattagaatcagtaatgaggtttataacgtg
ttttttccagtttttggacaatttcaagcatgcaatttaatgtgtgcaatcggtatagct
atctcgtctgggttggattacaaaaaaatgtgtatagataagcttatttctccaccggga
agaatggaaaaggtaaaaccttttgtgtttgtggactacgcacacactccaagtgcactt
aaacaagcgatattgtctttaaaatggcacttcaataaaaaaatagttctagtttttggt
tgtggtggtaatcgcgatcaggcaaaacgtgcagaaatgggtaaaatagcacaaatgtat
gcagagaaagttataatcacaaatgataatccacgtgatgaaaatccaacagaaattcgt
cgtgatattttgctacattgtcctgatgcagtagaggtagaagataggaaagaagctata
gaaaaaggtatagatatttcttacaataaaggcatgatcctgttgatcgcaggaaaagga
cacgaaagattccaaatcataaatggtcaagctcttgaattcagtgatgttgaggttgtt
agaaactatgcttcataa

DBGET integrated database retrieval system