KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_09280Help
Entry
wOo_09280         CDS       T02212                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wOo_09280
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wOo_09280
   00640 Propanoate metabolism
    wOo_09280
   00660 C5-Branched dibasic acid metabolism
    wOo_09280
Enzymes [BR:woo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     wOo_09280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(839818..840978)
Genome map
AA seq 386 aa AA seqDB search
MNVHEYQAKEILRKFNVPVLSGFVTTSAEGIETKINQLKSDILVVKAQIHAGGRGKAGGV
RLAKSTEEAQQLVKDMIGMTLLTHQTGPSGQQVKRVYIEEGSTIKKEYYLGLVVDLKLSR
PTFIFSSEGGMDIEKVAKSSPMKIVKLDISPASGFASFDSRKLSSSLNLSPEQIKKITSV
AKSVYNAFIATDANQIEINPLAETDSRDFVALDAKIDFDDNALYRHPEIAQLRDYDEEVK
EEIEASKHGLSYIKMDGNIGCMVNGAGLAMATMDIIKYYGAKPANFLDVGGGANKEAVTK
AFRIILSDSNVRGILVNIFGGIMRCDVVASGIVEAVKGMSIGVPLVVRLSGTNFKEGKRI
LEKSGLSIIATDELDEAAQKIVKEVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcatgaatatcaagcaaaagagatcttacgtaaatttaatgttccagtttta
agcggttttgttactacgtctgcagaaggaatagagactaaaataaatcaactgaagtct
gacatacttgtagttaaagctcagattcatgcaggtggaaggggcaaagctggcggtgta
agactggcaaagtcaactgaagaagctcaacagcttgtgaaggatatgattggtatgact
ttgctaactcatcaaacagggccaagtgggcagcaagtaaaaagggtttacattgaagag
ggttcaactattaagaaagagtattatttaggtttagtagttgatctaaaacttagcagg
ccaacattcatattttcttcagaaggtggaatggatattgaaaaagttgcgaagagctct
cctatgaaaatagtgaagctcgatattagtcctgcttctggttttgcaagttttgatagt
agaaagttaagcagtagtcttaatttaagtccagaacaaataaaaaaaataacaagtgtt
gcaaaaagtgtatataatgcatttattgcaactgacgcaaatcaaatagagattaatcca
ctagctgagacagattctagagattttgttgcgctcgatgcaaagattgattttgatgac
aatgctttataccgtcatccagaaattgcgcaactccgtgattatgatgaagaagtaaag
gaagaaatagaagcctcaaaacatgggcttagttatataaaaatggatggcaatattggt
tgcatggtgaatggtgcaggtcttgctatggcaacaatggatataataaagtactacgga
gcaaagccagccaactttttagacgttggcggtggagcaaataaggaagctgttaccaaa
gcatttaggattatattgtctgatagtaacgtaagaggaattttagttaacatatttggc
gggataatgcgttgtgatgttgttgcaagtggaattgttgaagctgtaaaaggaatgagt
attggagttcctctagtggttagattatcaggtactaattttaaagaaggaaaaagaatt
ttagagaaatcagggttaagtattattgctacggatgagctcgatgaagctgcacagaag
atagtaaaagaggtaaagtaa

DBGET integrated database retrieval system