KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_09280Help
Entry
wOo_09280         CDS       T02212                                 

Definition
(GenBank) succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00020  Citrate cycle (TCA cycle)
woo00640  Propanoate metabolism
woo01100  Metabolic pathways
woo01110  Biosynthesis of secondary metabolites
woo01120  Microbial metabolism in diverse environments
woo01130  Biosynthesis of antibiotics
woo01200  Carbon metabolism
Module
woo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
woo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wOo_09280
   00640 Propanoate metabolism
    wOo_09280
   00660 C5-Branched dibasic acid metabolism
    wOo_09280
Enzymes [BR:woo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     wOo_09280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CCF78439
UniProt: I7IAI2
Position
complement(839818..840978)
Genome map
AA seq 386 aa AA seqDB search
MNVHEYQAKEILRKFNVPVLSGFVTTSAEGIETKINQLKSDILVVKAQIHAGGRGKAGGV
RLAKSTEEAQQLVKDMIGMTLLTHQTGPSGQQVKRVYIEEGSTIKKEYYLGLVVDLKLSR
PTFIFSSEGGMDIEKVAKSSPMKIVKLDISPASGFASFDSRKLSSSLNLSPEQIKKITSV
AKSVYNAFIATDANQIEINPLAETDSRDFVALDAKIDFDDNALYRHPEIAQLRDYDEEVK
EEIEASKHGLSYIKMDGNIGCMVNGAGLAMATMDIIKYYGAKPANFLDVGGGANKEAVTK
AFRIILSDSNVRGILVNIFGGIMRCDVVASGIVEAVKGMSIGVPLVVRLSGTNFKEGKRI
LEKSGLSIIATDELDEAAQKIVKEVK
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttcatgaatatcaagcaaaagagatcttacgtaaatttaatgttccagtttta
agcggttttgttactacgtctgcagaaggaatagagactaaaataaatcaactgaagtct
gacatacttgtagttaaagctcagattcatgcaggtggaaggggcaaagctggcggtgta
agactggcaaagtcaactgaagaagctcaacagcttgtgaaggatatgattggtatgact
ttgctaactcatcaaacagggccaagtgggcagcaagtaaaaagggtttacattgaagag
ggttcaactattaagaaagagtattatttaggtttagtagttgatctaaaacttagcagg
ccaacattcatattttcttcagaaggtggaatggatattgaaaaagttgcgaagagctct
cctatgaaaatagtgaagctcgatattagtcctgcttctggttttgcaagttttgatagt
agaaagttaagcagtagtcttaatttaagtccagaacaaataaaaaaaataacaagtgtt
gcaaaaagtgtatataatgcatttattgcaactgacgcaaatcaaatagagattaatcca
ctagctgagacagattctagagattttgttgcgctcgatgcaaagattgattttgatgac
aatgctttataccgtcatccagaaattgcgcaactccgtgattatgatgaagaagtaaag
gaagaaatagaagcctcaaaacatgggcttagttatataaaaatggatggcaatattggt
tgcatggtgaatggtgcaggtcttgctatggcaacaatggatataataaagtactacgga
gcaaagccagccaactttttagacgttggcggtggagcaaataaggaagctgttaccaaa
gcatttaggattatattgtctgatagtaacgtaagaggaattttagttaacatatttggc
gggataatgcgttgtgatgttgttgcaagtggaattgttgaagctgtaaaaggaatgagt
attggagttcctctagtggttagattatcaggtactaattttaaagaaggaaaaagaatt
ttagagaaatcagggttaagtattattgctacggatgagctcgatgaagctgcacagaag
atagtaaaagaggtaaagtaa

DBGET integrated database retrieval system