KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_10110Help
Entry
wOo_10110         CDS       T02212                                 

Definition
succinate dehydrogenase subunit D sdhD hydrophobi c membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    wOo_10110
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wOo_10110
   00650 Butanoate metabolism
    wOo_10110
  Energy metabolism
   00190 Oxidative phosphorylation
    wOo_10110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(919778..920143)
Genome map
AA seq 121 aa AA seqDB search
MNQFRNSVHYWWVQRVSAVVLLLLFPWFIYLGFYVFYANASLPFNEKLLQAIDHPLELLF
FVILLFYIFWHAVLGIQVVCEDYIHSIPIKFFVITCIKYLSSVTYIVLAFTIFFFYRHIF
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttagaaattcagtacattattggtgggtacagcgtgtttctgcagtggtt
ttgctacttttattcccctggtttatctatttgggtttttatgtattttatgcaaatgct
tctttaccttttaatgaaaaattacttcaggctattgatcatcctctagaacttttgttt
tttgttatattactattttatattttttggcatgcagttcttggaatacaggtagtatgc
gaagattatatacacagcatacctataaagttttttgtaattacatgcataaagtactta
tcgagcgtcacttatatagtccttgcttttacaatttttttcttttacaggcatattttt
ttataa

DBGET integrated database retrieval system