KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_10110Help
Entry
wOo_10110         CDS       T02212                                 

Definition
(GenBank) succinate dehydrogenase subunit D sdhD hydrophobi c membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
woo00020  Citrate cycle (TCA cycle)
woo00190  Oxidative phosphorylation
woo00650  Butanoate metabolism
woo01100  Metabolic pathways
woo01110  Biosynthesis of secondary metabolites
woo01120  Microbial metabolism in diverse environments
woo01130  Biosynthesis of antibiotics
woo01200  Carbon metabolism
Module
woo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
woo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
woo_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    wOo_10110
   00650 Butanoate metabolism
    wOo_10110
  Energy metabolism
   00190 Oxidative phosphorylation
    wOo_10110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CCF78489
UniProt: I7IAJ2
Position
complement(919778..920143)
Genome map
AA seq 121 aa AA seqDB search
MNQFRNSVHYWWVQRVSAVVLLLLFPWFIYLGFYVFYANASLPFNEKLLQAIDHPLELLF
FVILLFYIFWHAVLGIQVVCEDYIHSIPIKFFVITCIKYLSSVTYIVLAFTIFFFYRHIF
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtttagaaattcagtacattattggtgggtacagcgtgtttctgcagtggtt
ttgctacttttattcccctggtttatctatttgggtttttatgtattttatgcaaatgct
tctttaccttttaatgaaaaattacttcaggctattgatcatcctctagaacttttgttt
tttgttatattactattttatattttttggcatgcagttcttggaatacaggtagtatgc
gaagattatatacacagcatacctataaagttttttgtaattacatgcataaagtactta
tcgagcgtcacttatatagtccttgcttttacaatttttttcttttacaggcatattttt
ttataa

DBGET integrated database retrieval system