KEGG   Wolbachia wOo (Onchocerca ochengi): wOo_10750Help
Entry
wOo_10750         CDS       T02212                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
woo  Wolbachia wOo (Onchocerca ochengi)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:woo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    wOo_10750
  Amino acid metabolism
   00300 Lysine biosynthesis
    wOo_10750
Enzymes [BR:woo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     wOo_10750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954019..955224
Genome map
AA seq 401 aa AA seqDB search
MKIDPVELTKKLISFKSITPKDDGAIEHIATILKKSGFKCKILEFGDSEAKVKNLYAKYI
NGVPNLCFAGHVDVVPPGQLKNWTSDPFNPKVRDGILYGRGAADMKSGVAAFIAAMVNFV
AGKSQFNGSISALITSAEESMEEYGTKAILEWMESKQKKMDYCVIAEPTSNEKLGDTIKI
GRRGSATFKLTCHGKQGHVAYPDLADNPIYKMISILSKIRNTTLDNGNKYFQPSNCEVTT
IDVGNNTDNLIPDLIVANFNIRYNDIQTPDTLFKLVNKICSSVTNNYKLSIYNNRGAFLS
IPDKNIDIMLDAINKVTNIDAVMSTSGGTSDAAFIKNVCPVVEFGMVNKTTHQVNECVLV
DDIHKLTTIYKEFIKNYFYPTNKIVNQINVISNMPDGPLLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatcctgtagagctaactaagaagttgatttcttttaagagcataacacca
aaagatgatggagcaatagaacatatagcaacaattcttaagaaaagtggctttaagtgt
aagattttagagtttggtgatagcgaagctaaagttaaaaatctctatgcaaaatatata
aatggagtgccaaatttatgttttgctggacatgttgatgttgtgccaccaggtcaatta
aaaaactggacatctgatccatttaatccaaaagttagagatggaatattgtatggaaga
ggagcagctgatatgaaaagtggagtagctgcatttattgctgctatggtaaactttgtt
gcaggaaaatctcagtttaacggttcgataagtgcattgattaccagtgctgaagaaagc
atggaagaatatggaacaaaagcaattttagagtggatggaaagtaaacaaaaaaagatg
gactattgtgtaattgctgaaccaaccagcaatgaaaaactaggcgacactataaaaata
ggcagaagaggatctgcaacattcaaattaacttgccatggaaaacaaggacatgttgcc
tacccagatttagctgataatccaatatataagatgatatcaatattgagtaagataaga
aatactactcttgataatggtaataaatattttcagccttcaaattgtgaggttactact
attgatgttggaaataatactgacaacctaatacccgatttaatagttgcaaatttcaac
attcggtataatgatatacaaacgcctgatactttatttaagttagtcaataagatatgc
tccagcgtaactaacaattataagctttctatttacaacaatagaggcgcctttctttct
attcctgataagaatattgatattatgcttgatgcaataaataaagttaccaatattgat
gctgtaatgagcacgagtggtggcacgtctgatgctgcatttatcaaaaatgtttgccca
gtggttgaatttggtatggtcaacaaaaccacacaccaagtaaatgaatgcgtgttagta
gatgatatacataaattaacaactatatataaggaatttataaaaaattatttttacccc
actaacaagatagtaaatcagattaatgtaattagcaatatgcctgatggtccattgcta
gcttaa

DBGET integrated database retrieval system