KEGG   Wolbachia wOo: wOo_10750Help
Entry
wOo_10750         CDS       T02212                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
woo  Wolbachia wOo
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:woo01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:woo00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
954019..955224
Genome map
AA seq 401 aa AA seqDB search
MKIDPVELTKKLISFKSITPKDDGAIEHIATILKKSGFKCKILEFGDSEAKVKNLYAKYI
NGVPNLCFAGHVDVVPPGQLKNWTSDPFNPKVRDGILYGRGAADMKSGVAAFIAAMVNFV
AGKSQFNGSISALITSAEESMEEYGTKAILEWMESKQKKMDYCVIAEPTSNEKLGDTIKI
GRRGSATFKLTCHGKQGHVAYPDLADNPIYKMISILSKIRNTTLDNGNKYFQPSNCEVTT
IDVGNNTDNLIPDLIVANFNIRYNDIQTPDTLFKLVNKICSSVTNNYKLSIYNNRGAFLS
IPDKNIDIMLDAINKVTNIDAVMSTSGGTSDAAFIKNVCPVVEFGMVNKTTHQVNECVLV
DDIHKLTTIYKEFIKNYFYPTNKIVNQINVISNMPDGPLLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgatcctgtagagctaactaagaagttgatttcttttaagagcataacacca
aaagatgatggagcaatagaacatatagcaacaattcttaagaaaagtggctttaagtgt
aagattttagagtttggtgatagcgaagctaaagttaaaaatctctatgcaaaatatata
aatggagtgccaaatttatgttttgctggacatgttgatgttgtgccaccaggtcaatta
aaaaactggacatctgatccatttaatccaaaagttagagatggaatattgtatggaaga
ggagcagctgatatgaaaagtggagtagctgcatttattgctgctatggtaaactttgtt
gcaggaaaatctcagtttaacggttcgataagtgcattgattaccagtgctgaagaaagc
atggaagaatatggaacaaaagcaattttagagtggatggaaagtaaacaaaaaaagatg
gactattgtgtaattgctgaaccaaccagcaatgaaaaactaggcgacactataaaaata
ggcagaagaggatctgcaacattcaaattaacttgccatggaaaacaaggacatgttgcc
tacccagatttagctgataatccaatatataagatgatatcaatattgagtaagataaga
aatactactcttgataatggtaataaatattttcagccttcaaattgtgaggttactact
attgatgttggaaataatactgacaacctaatacccgatttaatagttgcaaatttcaac
attcggtataatgatatacaaacgcctgatactttatttaagttagtcaataagatatgc
tccagcgtaactaacaattataagctttctatttacaacaatagaggcgcctttctttct
attcctgataagaatattgatattatgcttgatgcaataaataaagttaccaatattgat
gctgtaatgagcacgagtggtggcacgtctgatgctgcatttatcaaaaatgtttgccca
gtggttgaatttggtatggtcaacaaaaccacacaccaagtaaatgaatgcgtgttagta
gatgatatacataaattaacaactatatataaggaatttataaaaaattatttttacccc
actaacaagatagtaaatcagattaatgtaattagcaatatgcctgatggtccattgcta
gcttaa

DBGET integrated database retrieval system