KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_0062Help
Entry
WPa_0062          CDS       T00719                                 

Gene name
sucB
Definition
2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WPa_0062 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WPa_0062 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    WPa_0062 (sucB)
Enzymes [BR:wpi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     WPa_0062 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
56736..57908
Genome map
AA seq 390 aa AA seqDB search
MSKIIEIRAPKTLGGESVTEGIVKIKKNIGEAVKVDDLIFEIETDKTALELTAEASGQIT
EFFVKEDDIISPDQLLAKLAAGEVEEEVKKEDKGEGPDKKDAPSARKIMEENAISAENVK
GTGMGGRITKADVIDHMSKAEQPSVKQYESPKSVVSGERREERVKMSKIRQVIAARLKAS
QNTAAILTTFNEIDMKNVMDLRAKYKETFEKKYGIKLGFMSFFIKAAVQALKEIREINAE
ISGDEIVYKNYYDIGVAVGTDKGLVVPVIRDADQMSFAEIELTLVALGKKAREGKLQVSE
MEGATFTISNGGVYGSLLSTPIINPPQSGILGMHSIQNRPVAVSSSIEIRPMMYISLSYD
HRIVDGKGAVTFLVKIKNYIEDPNRLVLEI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaattatagaaatcagagcgccaaaaactcttggtggtgaatcagttacggaa
ggtatagtaaaaataaagaaaaatatcggcgaagcagtaaaagtagatgacttgatcttt
gaaattgaaactgataaaacggcgctagaactaactgcagaagcttcaggacaaataact
gaattttttgtgaaagaagatgatataattagccctgatcaattactggcaaaacttgct
gcaggagaagtagaagaagaagtgaaaaaagaagataaaggcgaaggccctgataaaaaa
gatgccccttcagctcgtaaaattatggaagaaaatgcaattagtgcagaaaatgtaaaa
ggaactggcatgggaggtagaataactaaagcggatgtgatagaccatatgagtaaagct
gaacaaccttcggtaaaacaatatgaatcgccaaaaagtgtagtaagtggagagagaaga
gaagagcgagtgaaaatgagcaaaataaggcaagtaatagctgctcgtttgaaagcatcg
caaaatactgctgcaatactgaccacgttcaatgaaattgacatgaaaaacgtcatggat
ctgagggcaaagtataaagaaacttttgaaaagaaatatggaataaaactgggtttcatg
tcgttttttataaaggcagcagtgcaagcactaaaagaaattcgtgagattaacgctgag
atttcaggtgatgaaattgtatataaaaattactatgacataggtgttgctgttggcact
gataaaggtcttgttgtaccagttattcgtgatgctgatcaaatgtcatttgctgaaatt
gaactaactttagttgctcttggcaaaaaagcacgagaaggtaagctgcaagtatcggaa
atggaaggtgcaacatttactatctcaaacggtggtgtatatggttcacttctttctact
ccgataataaaccctccgcaatctggaatacttggcatgcactcaatacaaaataggcca
gttgctgtgagtagctcaattgaaatcagacctatgatgtacatttccctctcttacgac
cacagaatagttgatggcaaaggagcagttactttccttgttaaaatcaaaaattacata
gaagatccaaatagattggttttggaaatttaa

DBGET integrated database retrieval system