KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_0494Help
Entry
WPa_0494          CDS       T00719                                 

Definition
malonyl-CoA decarboxylase
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    WPa_0494
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    WPa_0494
Enzymes [BR:wpi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     WPa_0494
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
531027..532403
Genome map
AA seq 458 aa AA seqDB search
MTKESLAKTDIVKVEDQKAPKSFFKILGEVANAVRSWVGNINPDLSSSRDVDSLVLKMNE
CLNPKGGEVSARKNTVSLGNLYLSLSEAGQIKFLQTLAEKFNPDKTKIDEEIKVYKKNQD
SESSYKFEQDLIKVLESPRSKILKQFISLPEGLKFIVDMRSDVLKLKNQYENLNPLENEL
KNILCTLVDVDLLDLHQITWDSPASLLEKLIKYEAVHKISSWGDLKNRLDSDRLCFAFFH
YKIPNEPLIFVEVALMNEISDSIQHLLDESVPSSDPSSASTAIFYSISNTQTGLSGISLG
NFLIKRVVEKLSQEFKSVKVYATLSPVPGFTKWLKNQDVALLGKLNIKQSGTEILESIKT
NIECEKQPLLKLCAHYLLKVKSSGGGAYDPVAHFHLSNGASIKQINWMADTSEKGISQSA
GIMVNYLYELPKIDNNHENYMINKVISHSKKVSAMLKE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaatcattagcaaaaactgatatagtgaaagttgaagatcagaaagcacca
aagagcttttttaagatactaggtgaagtagcaaacgctgtaagatcatgggttggcaat
attaaccctgatttaagtagtagtcgcgatgtcgatagtttagtcttgaagatgaacgaa
tgcttaaacccaaaggggggtgaagtctcagcacgtaagaacaccgtatctcttggtaat
ttgtacttgagtttatcagaggcaggtcaaataaaatttttacaaaccctggcagaaaag
ttcaatccggataaaacgaaaatagatgaagaaataaaagtatataagaaaaatcaagat
tctgagtcgagctataagtttgaacaagacttaataaaagtccttgaatcaccacgctct
aaaatattgaagcagtttatctccttaccagaaggtcttaagtttattgttgatatgcgt
tctgatgtgcttaagctaaagaaccaatatgaaaatctaaacccactagaaaatgaatta
aaaaatatactctgtactttggttgatgttgatctacttgatcttcatcaaatcacctgg
gattcacctgcatcattgttggaaaaacttataaaatatgaagctgtacataaaatttcc
tcttggggtgacttaaaaaacagactagattctgatcgtctctgttttgctttctttcat
tacaaaataccaaacgaacctctaatttttgtagaggttgcattgatgaatgagatttca
gatagtattcaacaccttttggatgagtcagtgccctcaagtgacccaagcagtgcaagt
actgctatattctattcaatatcaaacactcaaactggtttatctggaattagcctcggt
aactttttaataaagagagtcgtagaaaaactatcgcaagaatttaaaagcgtaaaagtg
tatgcaactctttctccagttcctggatttacaaaatggctaaaaaatcaagacgtagct
ttattaggtaagcttaatataaaacaatcaggtacagaaattttagaaagcataaaaact
aacattgaatgcgaaaaacagcccctactgaaactttgtgcacattatttgctaaaggtt
aaaagcagtggtggaggtgcttatgatccagtagcacactttcatttaagcaatggtgca
tcaatcaaacaaatcaactggatggctgatacttctgaaaaaggcattagtcagtcagcc
ggaataatggtgaattatctgtatgagctgcctaaaatagataacaatcatgaaaattat
atgattaataaagtgatttctcattcaaaaaaagtgtcagctatgttaaaggaataa

DBGET integrated database retrieval system