KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_0532Help
Entry
WPa_0532          CDS       T00719                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WPa_0532 (tpiA)
   01230 Biosynthesis of amino acids
    WPa_0532 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WPa_0532 (tpiA)
   00051 Fructose and mannose metabolism
    WPa_0532 (tpiA)
   00562 Inositol phosphate metabolism
    WPa_0532 (tpiA)
Enzymes [BR:wpi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WPa_0532 (tpiA)
Exosome [BR:wpi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WPa_0532 (tpiA)
  Exosomal proteins of bladder cancer cells
   WPa_0532 (tpiA)
  Exosomal proteins of melanoma cells
   WPa_0532 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
572297..572998
Genome map
AA seq 233 aa AA seqDB search
MSFLIVANWKMNGTRSSFVDFIGKLNNKSNEITSKLVICPPFTSFQSNIELNNNIKIGGQ
NCHHKEFGSYTGEISAGMLKELGCSYVILGHSERAHETDSEIKLKSETAIESGLHPIICV
GENSEDYKNKKTKEVIEYQCKNRLPTQGKYTIAYEPIWAIGTGNVPNNDAIAEVIKSCTG
KKHIIYGGSVSSENIENLLSIPNLSGVLIGSASLDFDHFYKIIQQVEKKFSLN
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttttaatagtagcaaattggaaaatgaatggaacacgttcttcatttgttgac
tttataggcaaacttaacaacaagagcaacgaaattacctctaaattagtaatttgccct
ccttttacatcatttcaaagcaatatagagttgaacaacaatattaaaataggaggacag
aattgccatcataaagagttcggttcttacacaggtgaaattagtgcaggaatgttgaag
gaactaggatgtagttacgtaatacttggacattctgaaagggctcatgaaacagatagt
gaaataaaactgaaatcagaaacagcaatagaatcaggattacacccaatcatctgtgta
ggtgaaaactcagaagattataaaaataaaaaaacaaaagaagtaatagaatatcaatgc
aaaaaccgtttgccaacacaaggtaaatataccatagcatacgaaccgatatgggcaata
ggaacaggaaatgtgccaaataatgacgcaattgctgaggtaataaaatcctgtactggt
aaaaaacacattatatatggtggttcagtcagttcagaaaatatagaaaacttgctcagt
attccaaatttatcaggagttttaattggcagtgcaagcttagattttgatcacttttat
aaaatcatacaacaagtcgagaaaaaattttctcttaattaa

DBGET integrated database retrieval system