KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_0676Help
Entry
WPa_0676          CDS       T00719                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    WPa_0676 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WPa_0676 (pyrB)
Enzymes [BR:wpi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     WPa_0676 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743082..743969
Genome map
AA seq 295 aa AA seqDB search
MDKRRNLLNISDLTIGDVENITKLANQYLEEKVENSHVLKNKIVINLFFEDSTRTLASFE
IAAKSLGANVITLPIKSSSINKGEDLKDMIKTLNAMNPDYMIIRHKSSGIINTLAKHVNC
SLINAGDGSSEHPTQALADYLVIISHKKQIKNLKIVICGDILHSRVARSNIRLLKMFGAK
ISLVAPPALMCKHFSEVDSLHYSLTEGIKDADVIMLLRLQKERMNNNSSEKEYFHLYGLD
AQKLSHAKPDAIVMHPGPINRGIEISNDIADCVILQQVKFGLATRKAVLHYLINV
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggacaagagaaggaatttattaaatatctcagacctcacaatcggtgatgtagaaaat
ataactaaattagccaaccaataccttgaagaaaaagttgaaaatagtcatgttctgaaa
aataaaatagtcataaacctattctttgaagattcaacacgtacgctcgcatcttttgaa
atagcagcaaagagccttggagcaaatgttataactttaccaataaaatcttcttctatt
aacaaaggggaagatctaaaagatatgataaaaacactaaatgcaatgaatcctgactat
atgataatcaggcataaaagtagtggtattattaatacattggcaaagcatgtcaattgc
tcgctaatcaacgcaggcgatggaagcagtgaacacccaactcaagctcttgcagattat
ctcgtaattatcagtcataaaaagcaaataaaaaacctcaaaattgtgatatgtggagat
attttgcacagtagagttgcaagatcaaatataagattgctaaaaatgtttggagcaaaa
ataagcttagttgcaccaccagctttgatgtgtaaacatttttctgaagtagattcactt
cattattcattaactgaaggtataaaggatgctgatgtaattatgctcttgaggttgcag
aaagagcgcatgaataataattcttcagaaaaagaatattttcatttgtatggacttgat
gcacaaaaactatcgcatgcaaaacccgatgcaattgttatgcacccaggaccaataaat
agaggtatcgaaattagcaatgatatagcagattgtgttattttacagcaagtaaagttt
ggattagcaacgcgtaaggcagtactgcactatttaataaatgtttaa

DBGET integrated database retrieval system