KEGG   Wolbachia pipientis: WPa_0760Help
Entry
WPa_0760          CDS       T00719                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
wpi  Wolbachia pipientis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:wpi00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:wpi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
826361..827638
Genome map
AA seq 425 aa AA seqDB search
MHKILVRSNHKPLIGKIKINGSKNAVLPIMAASLFSNSSITLHNVPDLIDVHLMSELLKS
LGAEVNFICNKDYKANHTLEIDCSNINNHLISHEIASRLRASFLMLGPMLSRFGRVSTVF
PGGCNIGKRPVDIHIKALEAMGAKIEIDSCNITATTKGKLQGKEITFEKVSVGATENIIM
SATLAEGVTTINNAATEPEVLDLIEFLKIMGANIEVNNTKITIEGVEALNGCEHKIIPDR
IEAGTYALAAIITDGELKLEGVSLSDIECIANELKTIGARVELHDDGIIISRKNGSIKSA
HVATNPYPNFPSDMQPQLMSAMSIAGGISIIEENVFESRFAHANELRKLGANISIEKNKA
TISGIKSLSGANLHANDLRSTAALILASLVAKGETTINNSHHLWRGYEAMHEKLNSCGAD
IFVSS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaatattagtaagaagtaaccataagcccttgattggaaaaatcaagattaat
ggttcaaagaatgcagtcttgccaataatggcggcaagcttgtttagtaattcttcaata
actttgcataacgtacctgatttaattgacgtgcatttgatgtctgagctgcttaagagt
cttggtgcagaagtaaattttatatgcaataaagactataaagcaaatcatactttggaa
attgactgtagcaatatcaataaccatttaatatcacatgaaattgcaagcagactgcga
gcatcttttttaatgctaggtccaatgctcagcagatttggtagagtttcaacagtattt
cctggtggatgtaatattggaaaacgtcctgttgacattcatatcaaggcacttgaagca
atgggagctaaaattgaaattgatagctgtaatataactgcaacaacaaagggaaaattg
caaggcaaagaaataacatttgaaaaagtaagtgttggcgcaacagaaaacataatcatg
tcagcaacacttgcagaaggagtaacaacaataaacaatgccgcaacggagccggaagtt
cttgatttaatagagtttctgaagattatgggtgccaatattgaagttaataatacaaaa
atcacaatagaaggtgttgaagcattaaatgggtgtgagcataaaataataccagatcgc
atagaggccggtacttatgctttggctgctatcattaccgacggcgagctaaagttagaa
ggagtaagtttgtctgatatagaatgtattgcaaatgaattgaagactataggagccaga
gttgagttacatgatgatggtattattatttctagaaaaaatggctctattaaatctgct
cacgttgcaacaaatccatatcccaactttcccagtgatatgcaaccacaactaatgtct
gctatgtcaattgcaggtggaatatcaatcattgaagagaacgtttttgaaagtagattt
gcacatgcaaatgagctaagaaaattaggtgctaatatcagcatcgaaaaaaataaagct
actataagtggaataaagagcttatctggagctaatctgcatgctaatgacttaaggtca
acagcagctttaattctcgcttctttggtagctaaaggagaaactacaataaataactca
catcatttatggagaggatatgaggcaatgcacgaaaaactcaattcatgcggggctgat
attttcgtttcatcttga

DBGET integrated database retrieval system