KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_0769Help
Entry
WPa_0769          CDS       T00719                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    WPa_0769 (recR)
DNA repair and recombination proteins [BR:wpi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      WPa_0769 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841295..841888
Genome map
AA seq 197 aa AA seqDB search
MNINIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKERVMLPLASLIRELADLIIECKICGN
LDTKSPCSICTNPKRDTKLMCVVEELGDLWAFEKGNIYSGMYHVLGGRLSAINGIGPKEL
NLDNIPKRVTEFKIEEVIIAINPTLEGQVTAQYIIELLKNSNVKISRLACGIPIGGEIDY
LDEGTLKIALTSRQDIK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaatataaagaatttagttcatgctttttctaaattgccaagtttaggtcca
tcatcatcacgaagattagttatacatttgctccagaacaaagagagagtcatgctaccg
cttgcatctttgattagagagctagcggatcttataatagagtgcaaaatttgtggaaac
ctagatactaaatcgccgtgttctatttgtactaacccaaagcgtgacaccaagttaatg
tgtgtagtagaagaattgggtgatctatgggcatttgaaaaagggaatatatattcaggt
atgtatcatgttttgggtggaaggctatcagcaataaatggcataggtccaaaagaactg
aatcttgataacattcccaaaagagttacagaatttaaaattgaagaggtcattattgca
atcaatccgacattagaaggccaagttactgcgcaatatataattgaattgctaaagaat
tcgaatgtaaaaatatcgcgccttgcttgtggtataccgataggtggagaaattgactac
ctagatgaagggactctgaagatagcgcttacttcaagacaggatattaaataa

DBGET integrated database retrieval system