KEGG   Wolbachia pipientis: WPa_0769Help
Entry
WPa_0769          CDS       T00719                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
wpi  Wolbachia pipientis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:wpi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
841295..841888
Genome map
AA seq 197 aa AA seqDB search
MNINIKNLVHAFSKLPSLGPSSSRRLVIHLLQNKERVMLPLASLIRELADLIIECKICGN
LDTKSPCSICTNPKRDTKLMCVVEELGDLWAFEKGNIYSGMYHVLGGRLSAINGIGPKEL
NLDNIPKRVTEFKIEEVIIAINPTLEGQVTAQYIIELLKNSNVKISRLACGIPIGGEIDY
LDEGTLKIALTSRQDIK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgaacattaatataaagaatttagttcatgctttttctaaattgccaagtttaggtcca
tcatcatcacgaagattagttatacatttgctccagaacaaagagagagtcatgctaccg
cttgcatctttgattagagagctagcggatcttataatagagtgcaaaatttgtggaaac
ctagatactaaatcgccgtgttctatttgtactaacccaaagcgtgacaccaagttaatg
tgtgtagtagaagaattgggtgatctatgggcatttgaaaaagggaatatatattcaggt
atgtatcatgttttgggtggaaggctatcagcaataaatggcataggtccaaaagaactg
aatcttgataacattcccaaaagagttacagaatttaaaattgaagaggtcattattgca
atcaatccgacattagaaggccaagttactgcgcaatatataattgaattgctaaagaat
tcgaatgtaaaaatatcgcgccttgcttgtggtataccgataggtggagaaattgactac
ctagatgaagggactctgaagatagcgcttacttcaagacaggatattaaataa

DBGET integrated database retrieval system