KEGG   Wolbachia pipientis: WPa_0989Help
Entry
WPa_0989          CDS       T00719                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
wpi  Wolbachia pipientis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:wpi00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:wpi02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056874..1057398
Genome map
AA seq 174 aa AA seqDB search
MELNKIAASILLSGLIIMIVSNVVDMLYNPEDYKIEHQTIVAASNEPQQKIEQVALDIGE
LMQNASFEKGKSAAKKCIACHSFEKGGMNKVGPNLWNVVGNKKAHLGSSFNYSKALLEKG
GKWEYEELFAFLKNPKAYIKGTRMAFAGISNPQEIADLVSYLRSMSDSPVALPK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaataagattgcagcatcgattttactttctggattaataattatgatagtt
agtaatgtagttgatatgctctacaacccagaggattataaaattgaacaccaaacaata
gtagcagccagcaatgagcctcaacaaaagattgaacaagtggcacttgatattggagag
ctcatgcagaatgctagctttgaaaaaggcaagtcagcagcaaaaaaatgtatagcttgt
catagttttgagaaaggtggaatgaataaagtggggccaaacttatggaacgtggttgga
aataaaaaggcccatcttggcagctcattcaattactcaaaagcactacttgaaaaaggt
gggaaatgggagtatgaggagttatttgcttttttaaaaaatccaaaagcctacataaaa
ggtacacgtatggcatttgcaggcatttccaatccacaagagattgcagatctagtcagc
tatttgcgttcgatgagcgatagtccggttgccttgccaaagtag

DBGET integrated database retrieval system