KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_0989Help
Entry
WPa_0989          CDS       T00719                                 

Definition
cytochrome c family protein
Orthology
K08738  
cytochrome c
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    WPa_0989
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    WPa_0989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1056874..1057398
Genome map
AA seq 174 aa AA seqDB search
MELNKIAASILLSGLIIMIVSNVVDMLYNPEDYKIEHQTIVAASNEPQQKIEQVALDIGE
LMQNASFEKGKSAAKKCIACHSFEKGGMNKVGPNLWNVVGNKKAHLGSSFNYSKALLEKG
GKWEYEELFAFLKNPKAYIKGTRMAFAGISNPQEIADLVSYLRSMSDSPVALPK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggagcttaataagattgcagcatcgattttactttctggattaataattatgatagtt
agtaatgtagttgatatgctctacaacccagaggattataaaattgaacaccaaacaata
gtagcagccagcaatgagcctcaacaaaagattgaacaagtggcacttgatattggagag
ctcatgcagaatgctagctttgaaaaaggcaagtcagcagcaaaaaaatgtatagcttgt
catagttttgagaaaggtggaatgaataaagtggggccaaacttatggaacgtggttgga
aataaaaaggcccatcttggcagctcattcaattactcaaaagcactacttgaaaaaggt
gggaaatgggagtatgaggagttatttgcttttttaaaaaatccaaaagcctacataaaa
ggtacacgtatggcatttgcaggcatttccaatccacaagagattgcagatctagtcagc
tatttgcgttcgatgagcgatagtccggttgccttgccaaagtag

DBGET integrated database retrieval system