KEGG   Wolbachia pipientis: WPa_1069Help
Entry
WPa_1069          CDS       T00719                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
wpi  Wolbachia pipientis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:wpi01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:wpi00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:wpi00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137968..1138333
Genome map
AA seq 121 aa AA seqDB search
MSQSVNSVHHWWIQRVSAVILLFLFPWFIYSFSCTFYVDSPLSFNEKLFQAINHPLELLF
FVILVFCIFWHAVLGMQVVCEDYIDSVLLRIFTITCIKYLSSITYIVLAFTTFFFYRHIF
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatctgtaaattcagtacatcattggtggatccagcgtgtttctgcggtgatt
ttgttatttttatttccttggtttatttactcattttcttgcacattttatgttgatagc
cctttatcttttaatgaaaaattatttcaggctattaatcatccactagagcttttgttt
tttgttatactggtgttttgcattttttggcatgcagttcttggaatgcaggtagtgtgt
gaagattatatagacagcgtacttctaaggatttttacaattacatgcataaaatactta
tcaagcattacttatatagtccttgcttttacgacttttttcttttataggcatattttc
ttgtaa

DBGET integrated database retrieval system