KEGG   Wolbachia wPip (Culex quinquefasciatus): WPa_1069Help
Entry
WPa_1069          CDS       T00719                                 

Gene name
sdhD
Definition
succinate dehydrogenase, hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WPa_1069 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WPa_1069 (sdhD)
   00650 Butanoate metabolism
    WPa_1069 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    WPa_1069 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137968..1138333
Genome map
AA seq 121 aa AA seqDB search
MSQSVNSVHHWWIQRVSAVILLFLFPWFIYSFSCTFYVDSPLSFNEKLFQAINHPLELLF
FVILVFCIFWHAVLGMQVVCEDYIDSVLLRIFTITCIKYLSSITYIVLAFTTFFFYRHIF
L
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaatctgtaaattcagtacatcattggtggatccagcgtgtttctgcggtgatt
ttgttatttttatttccttggtttatttactcattttcttgcacattttatgttgatagc
cctttatcttttaatgaaaaattatttcaggctattaatcatccactagagcttttgttt
tttgttatactggtgttttgcattttttggcatgcagttcttggaatgcaggtagtgtgt
gaagattatatagacagcgtacttctaaggatttttacaattacatgcataaaatactta
tcaagcattacttatatagtccttgcttttacgacttttttcttttataggcatattttc
ttgtaa

DBGET integrated database retrieval system