KEGG   Wolbachia pipientis: WPa_1097Help
Entry
WPa_1097          CDS       T00719                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
wpi  Wolbachia pipientis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:wpi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170884..1171882
Genome map
AA seq 332 aa AA seqDB search
MFNFPNIRLRRRRSGKWIRNLTSEITLSVNDLIFPLFVHDGEETIEPISGLPDIKCYSID
GLISIVQKAKDSGINAVAIFPVVDSKLKSEKAEEAYNPDNLICKAIHAVKSKVLDIGIIA
DIALDPYTTHGHDGILKDGKMDVENDETVSILCKQALVLAKAGCDIVAPSDMMDGRIGKI
RKTLDDNNFQNVSILSYAVKYCSSFYAPFRQVVGSCASSNFIDKSGYQMDYRNAREAICE
IEMDINEGADFIMIKPGMPYLDIIKTASDKFNFPIFAYQVSGEYAMIKAAANNGWLDYNR
VIYESLIGFKRAGASAIFTYAALDVAKNLVST
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgtttaactttccaaacataagattaagacgcaggcgctcaggcaagtggattcgcaat
ttaacaagtgaaatcactttatcagtaaatgatttgatttttcccttatttgttcatgac
ggagaagaaacaattgagccaatttctggcttacctgatatcaaatgttattcaatagat
ggattaatttctatagttcagaaagctaaggactcggggattaatgctgttgcaattttt
cctgtagttgatagtaaactaaaatctgaaaaagctgaggaagcatataatcctgataat
ttaatctgcaaagcaattcatgctgtaaaatcgaaggtacttgatattggcattattgca
gacattgcactagatccatacactactcacggtcatgatggcattttaaaagacggcaag
atggatgtggaaaatgatgaaactgtgtcaatattgtgtaagcaagcgcttgttttagca
aaagcaggatgcgatatagttgctccttctgatatgatggatggcaggataggaaaaata
agaaaaacattggatgataataactttcagaatgtgtcaatattgtcctatgcagtaaag
tactgttctagcttctatgcgccattcaggcaagttgtcggttcgtgcgcatcatcaaat
ttcatcgacaaaagtggttatcaaatggattatcgaaatgcacgcgaagcaatctgcgaa
attgaaatggatataaatgaaggtgcagattttattatgataaagccgggtatgccatac
ttagatataataaaaacagcaagtgacaagttcaattttccgatttttgcttaccaagta
agcggtgaatacgcaatgataaaagctgcagcaaataatggctggttggattataacaga
gtgatttatgagtccttaattggttttaaacgtgcaggtgcaagtgcaatatttacctat
gctgcacttgatgttgcaaaaaatttggtatctacttag

DBGET integrated database retrieval system