KEGG   Wolbachia pipientis: WPa_1128Help
Entry
WPa_1128          CDS       T00719                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
wpi  Wolbachia wPip (Culex quinquefasciatus)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:wpi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    WPa_1128
Enzymes [BR:wpi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     WPa_1128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1210408..1211115)
Genome map
AA seq 235 aa AA seqDB search
MKSILLTRPLLDSLSTRSTLKKYGYKVFIEPVFTIKYLNPDISAHEFDVVISTSKNSVKA
FSQICKEYGFPIITVGNSTMQAAKNLGFSDIISADSNVDGLISCIKSHYSNTIKFLYIRG
QEVSCDLKKRLSEEGFNVREVVLYKTITKRSLTNRCKNLLLDGKIDSVAFFSSQTARVFC
SLVLKSGLSPVMNNTVAYTMSKNIADSLKLIKWKKIITSRLPTGESLIDIINKDC
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctattttattgacaaggcctttattagattcgttgagcacaagaagcacgcta
aaaaaatatggatacaaagtttttatagagccagtattcacaataaagtacttaaatcct
gatatatccgcgcacgaatttgatgttgtgatatctacaagtaaaaacagtgtaaaggct
ttcagtcaaatatgtaaagagtatggctttccaattattacggttggtaattcaaccatg
caggctgcaaaaaatttgggattttccgatataatctcagcagacagcaacgttgatggt
ctgatatcatgcataaaatctcattattcaaatacaataaagttcttatatataagggga
caagaagtatcatgtgacctaaaaaaaagattatctgaagaaggttttaacgtaagagaa
gttgtactctataaaacaattactaaaaggagtctaactaataggtgtaaaaatttacta
ttggacggtaaaattgatagcgttgcttttttttcctcacaaactgcaagggtattttgt
tcattagttctaaaaagtgggctatctcctgtgatgaataatacagttgcatataccatg
agtaaaaacattgctgatagtttaaagttaatcaagtggaaaaaaattataacatcgagg
ttgcccacaggggagagtttaattgatataattaataaggattgttga

DBGET integrated database retrieval system