KEGG   Wolbachia wRi (Drosophila simulans): WRi_001590Help
Entry
WRi_001590        CDS       T00866                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
wri  Wolbachia wRi (Drosophila simulans)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:wri00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    WRi_001590 (tpiA)
   01230 Biosynthesis of amino acids
    WRi_001590 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    WRi_001590 (tpiA)
   00051 Fructose and mannose metabolism
    WRi_001590 (tpiA)
   00562 Inositol phosphate metabolism
    WRi_001590 (tpiA)
Enzymes [BR:wri01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     WRi_001590 (tpiA)
Exosome [BR:wri04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   WRi_001590 (tpiA)
  Exosomal proteins of bladder cancer cells
   WRi_001590 (tpiA)
  Exosomal proteins of melanoma cells
   WRi_001590 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(160267..160995)
Genome map
AA seq 242 aa AA seqDB search
MSFLIVANWKMNGMRSSFVDFIGKLNNKSNEITSKLVICPPFTSFPSSIELNNNINIGAQ
NCHHKKFGSYTGEISAEMLKELGCTYVILGHSERANEKDSEIKLKSEIAIESGLHPIICV
GENSEDYKNEKTKEVIEYQCKNRLPTHGEYTVAYEPIWAIGTGHVPNNDAIAKVIEVIKL
CTSKKHIIYGGSVSSENIENLLNISNLSGVLIGSASLDFDHFYKIIQQVEKKFSLINSKI
SN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttttaatagtagcaaattggaaaatgaatggaatgcgttcttcatttgttgac
tttataggcaaacttaacaacaagagcaacgaaattacctctaaattagtaatttgccct
ccttttacgtcatttccaagcagtatagagttgaacaataatattaatataggagcacag
aattgccatcataaaaagttcggttcttacacaggtgaaattagcgcagaaatgttaaaa
gaactagggtgtacttacgtaatacttgggcattctgaaagggccaatgaaaaagatagt
gaaataaaacttaagtcggaaatagcaatagaatcaggcttacacccaattatctgtgta
ggtgaaaattcagaagattataagaatgaaaaaacaaaagaagtaatagaatatcaatgt
aaaaaccgcttgccaacacacggtgaatataccgtagcatatgagccaatatgggcaata
ggcacaggtcatgtgccaaataatgatgcaattgctaaggtgatagaggtaataaaattg
tgtactagtaaaaaacacattatatatggtggttcagtcagttcagaaaatatagaaaat
ttgttaaatatttcaaatttatcaggagttttaattggcagtgcaagcttagatttcgat
cacttttataaaattatacaacaagttgaaaaaaagttttctcttatcaattctaaaatc
agcaactaa

DBGET integrated database retrieval system